KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377195Help
Entry
101377195         CDS       T05148                                 

Gene name
TGM6
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101377195 (TGM6)
Enzymes [BR:oro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101377195 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core FixG_C
Motif
Other DBs
NCBI-GeneID: 101377195
NCBI-ProteinID: XP_004398276
UniProt: A0A2U3VSL8
LinkDB All DBs
Position
Unknown
AA seq 723 aa AA seqDB search
MAAKSVLPVSWAFGGLGAGGIRVTKVDWLSRKNGAAHHTQEYPGPELVVRRGQAFTLVLE
LNRPLEEQETIIFTMETGPQASEEHHTKAVFQISEPEVGKTWTAVEEAQTENSMTVSITS
PPSAVIGRYLMSTRVSSRRKQNDRKLGEFVLLFNPWCPEDDVFLDSEEERQEYVLNDSGI
IFRGVEKHIRAQGWNYGQFEEDILNICLSILDRSPLHQNDPTTDVSRRHDPIYISRAISA
MVNSNNDRGVVQGQWQGKYGGGTSPLHWSGSVAILHKWFKGRFKPVKYGQCWVFAGVMCT
VLRCLGIATRVVSNFNSAHDTDRNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQ
DLGPSYNGWQVLDATPQEESEGVFRCGPASVTAIRQGDVHLAHDGPFVFAEVNADYITWL
WHKDGSWERVYSDTKKIGRCISTKAVGSDSRVDITGLYKYPEGSRKERQVYRKAVRKLFS
VEASRRRARVHRVGGRGLWREDLLEPAARPNITGKFKMLEPPMLGHDLSLALRLTNLTSR
PQRVRVNLSGATILYTRRSVAEILHESHAVRLGPEEEKEIPITISYSQYKEDLTEDKKIL
LAAMCFVTKGEKLLVEKDITLEDFITIKVLGPAVVGVAVVVKVTVVNPLLEKVEDCVLMV
EGSGLLQGQLSIDVPSLEPQERASVQFNITPSKSGPRQLQVDLVSPHFPDIKGFVIIHVA
TAK
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaagtcggtgctgcctgtcagctgggcgttcggggggctgggggctgggggg
atcagagtcaccaaggtggactggctgagccggaagaacggtgctgcccaccacacccag
gagtaccccggccctgagctggtggttcgcaggggccaggcgttcaccttggtgctggag
ctcaacagacccctggaggagcaggagaccatcatcttcaccatggagacaggaccccag
gcttctgaggaacaccacaccaaagctgtgttccagatatcggagccagaagtgggcaag
acctggacagccgtggaggaggctcagacagagaacagcatgaccgtcagcatcaccagc
cctcccagcgctgtcatcggccgctacctgatgagcaccagggtctcctctcgccgaaaa
caaaatgaccggaagctgggcgaatttgttctccttttcaacccgtggtgcccagaggac
gacgtgtttctggactcagaggaggagagacaggagtatgtgctgaatgacagcgggatc
atcttccgaggcgtggagaagcacatccgagcccagggctggaactacgggcagtttgag
gaggatatcttgaacatctgcctctccatcctggaccgaagtccccttcaccaaaacgac
cccaccactgatgtgtcccgccgccacgaccccatctacatcagcagggccatcagcgcc
atggtgaacagcaacaatgaccggggcgtggttcaaggccagtggcagggcaagtacggc
ggcggcaccagccccctgcactggagcggcagtgtggccattctgcacaagtggttcaag
ggcaggttcaagccagtcaaatacggccagtgctgggtcttcgctggagtcatgtgcaca
gtccttaggtgcctggggatcgccacccgggtggtgtccaactttaactcagcccatgat
acggacaggaatctgagtgtggacaaatacgtggactccttcgggcggacgctggaggac
ctgacagaagacagcatgtggaatttccatgtctggaatgagagttggtttgcccgccag
gacctgggcccctcctacaatggctggcaggttctggatgccaccccccaggaggagagc
gaaggcgtgttccggtgtggcccggcctccgtcaccgccatccgtcagggcgacgtgcac
ctggcccacgatggcccctttgtgttcgcggaggtcaacgcagactacatcacctggctg
tggcacaaggatgggagctgggagcgggtatactcggacacaaagaagatcgggaggtgc
atcagcaccaaggccgtgggcagcgactcccgcgtggacatcaccggcctctacaagtat
ccagaagggtcccggaaggagaggcaggtgtaccgcaaggccgtgaggaagctgttcagt
gtggaagcctccaggaggagggcccgggtccacagggtgggcggccgtggtctttggcgc
gaggacctcctggagcccgccgccaggcccaacatcaccggcaagttcaagatgctggaa
ccgcccatgctgggccacgacctgagcctggctctgcgcttgaccaacctcacctcccgg
ccccagagggtccgagtcaacctgagcggtgccaccatcctgtacacccgcaggtcggtg
gccgagatcctgcacgagtcccacgcggtgcggctggggccggaagaagagaaagagatc
ccaatcacaatatcttactctcaatataaggaagatctgacagaggacaagaagatcctg
ttggctgccatgtgctttgtcaccaagggagagaagctcctggtggagaaagacatcact
ctagaggacttcatcaccatcaaggtgctgggccccgccgtggtgggggtggcggttgtg
gtgaaagtgacggtggtcaacccccttctggagaaagtggaggactgcgtgctgatggtg
gagggcagtggccttctccagggacagctcagcatcgatgtgcccagcctggagccccag
gagagggcctcggtccagttcaacatcaccccatccaagagcggcccgaggcagctgcag
gtggacctcgtcagcccccacttcccggacatcaagggctttgtgatcatccacgtggcc
acagccaagtga

DBGET integrated database retrieval system