KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377281Help
Entry
101377281         CDS       T05148                                 

Gene name
TUFM
Definition
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
Translation factors [BR:oro03012]
 Eukaryotic Type
  Elongation factors
   101377281 (TUFM)
 Prokaryotic Type
   101377281 (TUFM)
Mitochondrial biogenesis [BR:oro03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    101377281 (TUFM)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101377281 (TUFM)
  Exosomal proteins of breast cancer cells
   101377281 (TUFM)
  Exosomal proteins of colorectal cancer cells
   101377281 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 101377281
NCBI-ProteinID: XP_004397209
LinkDB All DBs
Position
Unknown
AA seq 452 aa AA seqDB search
MAATTLLRATPLLSGLGAGPSPLLQSVLRPLKVPALPRLCRGLAVEAKKTYVRDKPHVNV
GTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAAR
HYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYV
NKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGVKSVQKLL
DAVDTYIPVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECEFLGHSKNIR
TVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMAKPGSIQTHQKVEAQVYILS
KEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPGKELAMPGEDLKISLVLRQPMILEKGQ
RFTLRDGNRTIGTGLVTETPAMTEEDKNLKWS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccaccctgctgcgcgcgacgcccctcttgagcggtctcggcgccggcccg
agcccactgctgcagagtgtgttgcggccgctgaaggtgccggcactgcctcgcttgtgc
cgtggcctggccgtggaggccaagaagacctatgtgcgcgacaagccccatgtgaacgtg
ggcaccatcggccatgtggaccacggcaagaccacactgaccgcggccatcacgaagatt
ttagcggagggaggcggagcgaaatttaagaaatatgaagagattgacaatgctcctgaa
gagcgagcccgtggaatcacaattaatgcggctcacgtggagtatagcactgcagcccgc
cactatgcccacacagactgcccaggtcacgcagattacgttaagaatatgatcacaggc
accgcccccctcgacggctgcatcctggtggtggcggccaatgacggccctatgccccag
acccgagagcatctattactggccaaacagattggagtagagcatgttgtggtgtacgtg
aacaaagcagatgctgtccaggactctgagatggtggagctggttgagctggagatccgg
gaactgctcactgagtttggctacaaaggggaggagaccccggtcatcgtaggctctgcc
ctctgtgcccttgagcaacgtgaccctgagctaggcgtgaagtctgtgcagaagctgctg
gatgccgtggacacttatatcccggtacccacccgagacctggagaaacctttcctgctg
cctgtagagtccgtttactctattcccggccggggcacagtggtgacaggtacactagag
cgtggcattttgaagaaaggagatgagtgtgagttcctgggacacagcaagaacattcgc
actgtggtgacaggcattgagatgttccacaagagtctggagagggcagaggcaggcgac
aaccttggagccctggtccgaggcttgaagcgagaggacctgaggcgtggcctggtcatg
gccaagccagggtccatccagacccaccagaaggtggaggcccaggtttatatcctcagc
aaagaggaaggtggccgccacaagccttttgtatcccacttcatgcctgtcatgttctcc
ctgacttgggacatggcctgtcgtatcatcttaccgccagggaaggagcttgccatgccc
ggggaggacctgaagatcagccttgtcttgcggcagcccatgatcttagaaaaaggccag
cgtttcaccctgcgagatggcaaccggaccatcggcactggccttgtcactgagacgcca
gccatgaccgaggaagacaagaacctcaagtggagttga

DBGET integrated database retrieval system