KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377292
Entry
101377292         CDS       T05148                                 

Gene name
ANPEP
Definition
(RefSeq) aminopeptidase N
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00480  Glutathione metabolism
oro01100  Metabolic pathways
oro04614  Renin-angiotensin system
oro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101377292 (ANPEP)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101377292 (ANPEP)
  09152 Endocrine system
   04614 Renin-angiotensin system
    101377292 (ANPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oro01002]
    101377292 (ANPEP)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101377292 (ANPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101377292 (ANPEP)
   04090 CD molecules [BR:oro04090]
    101377292 (ANPEP)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     101377292 (ANPEP)
Peptidases and inhibitors [BR:oro01002]
 Metallo peptidases
  Family M1
   101377292 (ANPEP)
Membrane trafficking [BR:oro04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    101377292 (ANPEP)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101377292 (ANPEP)
CD molecules [BR:oro04090]
 Proteins
  101377292 (ANPEP)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 101377292
NCBI-ProteinID: XP_004398356
UniProt: A0A2U3VSX1
LinkDB
Position
Unknown
AA seq 973 aa
MAKGFYISKTLGILLIILGVAAVCTIIALSVVYAQEKNKNTGSSTEGPTTVPTAGPTKPM
TTTATTTATTLDQSKPWNHYRLPKTLIPSSYNVTLQPYLTPNSEGLYTFHGTSTVRFMCN
ESTNVIIIHSTKLNYTNIQGQRVALRGVGGTQTPTIDTTELVELTEYLVVHLREPLQVNG
QYEMDSDFHGELADDLAGFYRSEYTENGVKKVLATTQMQATHARKSFPCFDEPAMKATFN
ITLIHPSNFVALSNMLPRGPSVPLPGDDKWVVTEFETTPVMSTYLLAYIVSEFKNVEKTA
PSGVLIRIWARPSGIDQGHGSYALNVTGPILDFFSAHYDTLYPLNKSDQIALPDFNAGAM
ENWGLVTYRENSLLYDPQSSSSSNKERVATVIAHELAHQWFGNLVTLEWWNDLWLNEGFA
SYVEYLGANYAEPTWNLKDLMVLNDVYRVMAIDALASSHPLSSPANEVNTPAQISEMFDS
ISYSKGASVLRMLSSFLTEDLFKKGVASYLHTFSYKNTIYLDLWDHLQKVNDQTTIKLPD
TVRNIMDRWILQMGFPVITVNTTTGTISQEHFLLDSKSVVTRPSEFNYLWIVPITSVKNG
MQQADYWLQGNAQAQNDLFKTTANEWVLLNLNVTGYYLVNYDEENWRRIQTQLQTNLLVI
PVINRAQVIHDTFSLASAQKVPVTLALNSTLFLIQEREYMPWEAALSSLSYFKLMFDRSE
VYGPMKTYLRKQVTPLFDHFEKITHNWTVHPQNLMEQYSEINAVSTACAYGVPKCKELVS
TLFAKWRKDPQNNPINPNLRSIIYCNAIAQGGEEEWNFMWEQFQNATLVNEADKLRAALA
CSNQVWILNRYLSYTRNPDLIRKQDVTSTLSSIASNVVGQNLVWDFVQSNWKKLFEDFGT
GSFSFSNLIQAVTRRFSTEFELQQLQQFKTNNMDVGFGSATRALEQALEKTKANIKWVKE
NKEVVLKWFTENS
NT seq 2922 nt   +upstreamnt  +downstreamnt
atggccaagggcttctacatttccaagactctgggcatcctgctcatcatcctgggggtg
gcagccgtgtgcaccatcatcgctctgtccgtggtgtatgcccaggagaagaacaagaac
accgggagctccaccgagggccccacgacagtccccacggcgggccccacaaagcccatg
accactacagccaccaccacggccaccaccttggaccaaagcaaaccatggaaccattac
cgcctccccaagactctgattcccagctcctacaacgtgacgctgcagccctacctcacc
cccaacagtgagggcctgtacaccttccatggcaccagcaccgttcgcttcatgtgcaat
gagtccaccaacgtcatcatcatccacagcacgaagctcaactacaccaacatccagggg
caaagggtggccctgcggggcgtggggggcacgcagacccccaccattgacacaaccgag
ctggtggagctcactgagtacctggtggtgcacctccgggagccactgcaggtcaatggc
cagtacgagatggacagcgatttccatggggagctggctgacgacctggcgggcttctac
cgcagcgagtatacagagaacggtgtcaaaaaggtgctggccacaacacaaatgcaggct
acacatgcccggaaatccttcccgtgcttcgacgagccagccatgaaggccacgtttaac
atcaccctcatccaccccagcaacttcgtggcattgtccaacatgctgcccagaggcccc
agtgtccctcttccgggagatgacaagtgggttgtcaccgagtttgaaaccacgcctgta
atgtctacttacctgctggcctacatcgttagtgagttcaagaatgtggagaagacagcg
cccagtggcgtcctgatccgaatctgggctcggcctagtgggatcgaccagggccatgga
agttatgccctgaatgtgacaggccccatcctagacttcttttccgcacattatgacaca
ctctacccactcaacaaatctgaccagatcgccttacctgacttcaacgctggcgccatg
gagaactgggggctggtgacctaccgggagaactccctgctctatgacccgcagtcctcc
tccagcagcaacaaggagcgagtggccaccgtgattgctcacgagctggcccaccagtgg
tttgggaacctggtgaccttggaatggtggaatgacctgtggctgaacgagggctttgcc
tcctacgtggagtacctgggcgccaactatgcagagcccacctggaatctgaaagacctc
atggtgctgaacgacgtgtacagggtgatggccatagatgcgctggcctcctcccacccg
ctgtcctcacctgccaacgaggtcaacacgccggcccagatcagcgagatgttcgactcc
atctcctacagcaagggagcttcggtcctcaggatgctctccagcttcctgacggaggat
ctgttcaagaagggcgtggcgtcctacctccacaccttttcctacaaaaacaccatctac
ctggacctgtgggaccacctgcagaaggtcaacgatcaaacaaccatcaagctgccggac
accgtgcgcaacatcatggaccgctggatcctgcagatgggcttcccggtcatcaccgtg
aacaccaccacgggcaccatctcccaggagcacttcctccttgactccaagtctgtcgtc
acccgcccctcagagttcaactacctgtggattgtgcccatcacttccgtcaaaaatggc
atgcagcaggcggactactggcttcaaggcaatgcacaggcccagaatgacctgttcaaa
accacagctaatgagtgggtcctgctgaacctcaacgtgacgggctactacctggtgaac
tatgacgaagagaactggagaaggatccagactcagctgcagacaaacctgttggtcatc
cctgtcatcaaccgggctcaggtcatccatgacaccttcagcctggccagtgcccaaaag
gtccctgtcaccctggcgctgaacagcactctcttcctgatccaagagagagagtacatg
ccctgggaggccgccctgagcagcctgagctacttcaagctcatgttcgaccgctctgag
gtctacggccccatgaagacctacctgaggaagcaggtcacgcctctcttcgatcatttc
gaaaaaatcacccacaactggactgttcacccacagaacctgatggaacagtacagcgag
attaacgccgtcagcactgcctgcgcctatggggttcctaagtgcaaggagctggtctca
actcttttcgcaaagtggaggaaggacccccaaaataacccgatcaaccccaacctgcgc
tccatcatatactgcaatgccattgcccagggtggtgaggaggagtggaacttcatgtgg
gaacagttccaaaacgccacgctggtaaacgaggccgacaaactccgtgcagccctggcc
tgcagcaaccaggtctggatcctgaacaggtacctgagttacaccaggaaccctgacctc
atccggaagcaagatgtcacctccacgcttagcagcatcgccagcaatgtcgtcgggcaa
aatctggtctgggacttcgtccagagcaactggaagaagctctttgaggacttcggcact
ggctccttctccttctccaacctcatccaggcagtgacgcgacggttctccacggagttc
gagctgcagcagctgcagcagttcaagacaaacaacatggacgtaggcttcggctcagcc
actcgggctctggagcaagccctggagaagaccaaagcgaacatcaagtgggtgaaagaa
aacaaggaagtggtgctcaaatggttcacagaaaacagctaa

DBGET integrated database retrieval system