KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377393
Entry
101377393         CDS       T05148                                 

Gene name
ZAP70
Definition
(RefSeq) tyrosine-protein kinase ZAP-70
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04014  Ras signaling pathway
oro04064  NF-kappa B signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro05135  Yersinia infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101377393 (ZAP70)
   04064 NF-kappa B signaling pathway
    101377393 (ZAP70)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101377393 (ZAP70)
   04660 T cell receptor signaling pathway
    101377393 (ZAP70)
   04658 Th1 and Th2 cell differentiation
    101377393 (ZAP70)
   04659 Th17 cell differentiation
    101377393 (ZAP70)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101377393 (ZAP70)
  09163 Immune disease
   05340 Primary immunodeficiency
    101377393 (ZAP70)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101377393 (ZAP70)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101377393 (ZAP70)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101377393 (ZAP70)
Protein kinases [BR:oro01001]
 Non-receptor tyrosine kinases
  SYK family
   101377393 (ZAP70)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Haspin_kinase RIO1 Kdo
Other DBs
NCBI-GeneID: 101377393
NCBI-ProteinID: XP_004400200
UniProt: A0A2U3VXL8
LinkDB
Position
Unknown
AA seq 326 aa
MCPARLVSSEKAQPMPMDTSVYESPYSDPEELKDKKLFLKRENLLMADIELGCGNFGSVR
QGVYRMRKKQIDVAIKVLKHSTEKTDKDEMMREAQIMHQLDNPYIVRLIGVCQAEALMLV
MEMAGGGPLHKFLLGKKEEIPISNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRH
YAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECFNFRKFSSRSDVWSYGVTMWEAF
SYGQKPYKKMKGPEVIAFIEQGKRMECPAECPPEMYTLMNDCWIYKWEDRPDFQAVEQRM
RAYYYSMASKSEGPPGCGKGTEAASI
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtgcccagcacgcctagtgtcctcagagaaagcacagccaatgcccatggacacgagt
gtgtatgagagcccctacagtgaccctgaggagctcaaggacaagaagctcttcctgaag
cgggagaacctcctcatggctgacatagaacttggctgtggcaactttggctcagtacgc
cagggcgtctaccgcatgcgcaagaagcagatcgatgtggccatcaaggtgctgaagcac
agcacggagaagacagacaaggatgagatgatgcgcgaggcacagattatgcaccagttg
gacaacccctacatcgtgcggctcatcggcgtctgccaggccgaggccctcatgctcgtc
atggagatggcaggcggcgggcccctgcacaagttcctgctcgggaagaaagaggagatc
cccatcagcaatgtggcggagctgctgcaccaggtgtccatggggatgaaatacctggaa
gagaaaaactttgtgcaccgtgacctggcggcccgcaatgtcttgctggtcaaccggcac
tacgccaagatcagtgactttggtctctccaaggcactgggtgccgacgacagctactac
actgcccgctcggcagggaagtggccgctcaagtggtatgcgcctgagtgcttcaacttc
cgcaagttctccagccgcagtgacgtctggagttatggggtcaccatgtgggaggccttc
tcctatggccagaagccctacaagaagatgaagggccccgaggtcatagccttcatcgag
cagggcaagcggatggagtgcccggcagagtgtccgcctgaaatgtatacactcatgaat
gactgctggatctacaagtgggaggaccgcccagacttccaggccgtggagcagcgcatg
cgggcctactactacagtatggcaagcaagtctgaaggccccccagggtgtggaaagggg
actgaggctgcttctatctga

DBGET integrated database retrieval system