KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377413Help
Entry
101377413         CDS       T05148                                 

Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04614  Renin-angiotensin system
oro04924  Renin secretion
oro05142  Chagas disease (American trypanosomiasis)
oro05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:oro00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    101377413
   04614 Renin-angiotensin system
    101377413
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101377413
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    101377413
Enzymes [BR:oro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101377413
Peptidases [BR:oro01002]
 Metallo Peptidases
  Family M2
   101377413
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101377413
CD molecules [BR:oro04090]
 Proteins
  101377413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 101377413
NCBI-ProteinID: XP_004405943
LinkDB All DBs
Position
Unknown
AA seq 1312 aa AA seqDB search
MGAASGRKRRGPPPLLLLPPLLLLLPPPPPAALALDPDLQPGNFAADEAGAQLFVQSFNS
SAELVMYQSTVASWAYDTNITEENARRQEEAALLNQEFAEVWGQKAKELYDPIWQNFSDP
ILRRVISGVRTLGPANLPVEKRQQYNSLLSNMNRIYSTARVCFYPNKTAICWSLDPELTH
IMAISRNYALLLYAWEGWHNAVGTPLKPLYQNFTSLSNEAYQKDGFSDTGAYWRSWYESP
TFVEDLEHLYHQVEPLYLNLHAHVRRTLHRRYGDRYINLRGPIPAHLLGDMWAQSWDNLY
DMMVPFPDKPSLDVTSTMVRKGWNTTHMFRVAEEFFTSLGLSPMPPEFWAGSMLEKPTDG
REVVCHASAWDFYNRRDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKEQPVSLRQGANP
GFHEAIGDVLALSVSTPAHLYKIGLLDNVSNDMESDINFLLKMALEKIAFLPFGYLVDQW
RWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNETHFDAGAKFHVPNVTPYIRYFVSF
VLQFQFHQALCKEAGQQSPLHKCDIYQSTQAGAKLREALRAGSSRPWQEVLKEAIGTDTL
DAQPLLDYFQPVYRWLREQNERHGEVLGWPEYQWRPPMPNNYPQDIGLVTDEVEARRFVE
EYDRRSQVIWNEYAEANWNYNTNITTEASKILLQKNIQMANHTFKFGTWARQFDVTNFQN
ASIKRMIKKIQDLERAALPAKELEEYNQILLDMETTYSVASVCHTNGTCLQLEPDVTNLM
ATSRRYEDLLWAWKGWRDKVGRAILPSFPKYVELANKAARLNGYEDAGDSWRVMYEIPSL
EQDLEQLYQELQPLYLNLHAYVRRALHRHYGPQHINLEGPIPAHLLGNMWAQTWSNIYDL
VVPFPSAPKIDATEAMIKQGWTPKRMFEEADNFFTSLGLLPVPFEFWNKSMLEKPTDGRE
VVCHASAWDFYNGKDFRIKQCTTVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGANPGF
HEAIGDVLALSVSTPKHLHSINLLSSESGGYEQDINFLMKMALDKIAFVPFSYLVDQWRW
RVFDGSITKENYNQEWWNLRLKYQGLCPPVPRSQGDFDPGAKFHVPSNVPYIRYFVGFVI
QFQFHEALCQAAGHNGPLHTCDIYHSKEAGKRLADAMKLGFSKPWPEAMKLITGQSNMSA
SAMMNYFKPLLDWLLTENRRHGEKLGWPQYNWTPTSARSEGPFPGTGRVSFLGLDLEEQQ
ARVGQWVLLFLGVALLVATLGLTQRLFSIRHHSLRQPHRGPQFGSEVELRHS
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtcgggccgaaagcggcgggggccgccgccgctgctgctcctgccgccg
ctgctgctgctgctgccgccgccgccgcccgccgccctggcgctcgaccccgacctgcag
cccggaaactttgccgccgacgaggccggggcgcagctcttcgtgcagagcttcaactcg
agcgccgagctggtgatgtaccagagcacggtcgccagctgggcgtacgacaccaacatc
accgaggagaacgcgcggcgccaggaggaagcagccctgctcaaccaggagtttgctgag
gtctggggccagaaggccaaggagctatacgacccaatctggcagaacttcagcgaccca
atcctgagaagggtcatcagcggtgtgcgcaccctgggccctgccaacctgcctgtggaa
aagcggcagcagtacaactctctgctaagcaacatgaacaggatctactccacagccagg
gtctgcttctatcccaacaagactgccatctgctggtccctggacccagagctcacccac
atcatggccatctcaagaaactacgcattgctgctctatgcctgggagggttggcacaat
gcggtgggcaccccgctgaagcccctgtaccagaacttcacttccctcagcaatgaggct
taccagaaggatggcttctcagacacaggggcctactggcgctcctggtatgagtcaccc
accttcgtggaggatctggagcacctctaccatcaagtagagcccctctacctgaacctc
catgcccacgtccgccgcacactgcaccgccgatatggagacagatacatcaacctcagg
ggacccatccctgctcacctgctgggggacatgtgggcccagagctgggacaacctgtat
gacatgatggtgcctttccctgacaagccgagtctcgatgttaccagtactatggtgcgg
aagggttggaacactacgcacatgttccgggtggcagaggagttcttcacctccctaggc
ctctcgcccatgcctcctgagttttgggcagggtccatgctggagaaaccaaccgacggg
cgggaggtggtgtgccatgcctctgcctgggacttctacaacaggagagatttcaggatc
aagcagtgcacgcgggtcactatggaccagctgtccacggtgcaccacgagatgggccac
gtgcagtactatctgcagtacaaggagcagcctgtctccctgcgccaaggggccaaccct
ggcttccacgaggccatcggggatgtgctggcgctctccgtctctactcctgcacatctg
tacaaaattggcctgctggacaatgtcagcaatgacatggaaagtgacatcaatttcctg
ttgaagatggcactggaaaaaattgccttcctgccctttggctacttggtagaccagtgg
cgctggggggtctttagtgggcgtacccccccttcccgctacaactttgactggtggtat
cttcgaaccaagtatcaggggatctgtcctccagttgcccgaaatgaaacccactttgat
gctggagctaagtttcatgtcccaaatgtgacaccgtacatcaggtacttcgtgagtttt
gtcctgcagttccagttccatcaagcgctgtgcaaggaggcgggccaacagtccccactg
cacaagtgtgacatctaccagtccacacaggcaggggccaagctccgggaggcactgcgg
gcaggctcctcacggccctggcaggaggtgctgaaggaggcgattggcacagacaccctg
gacgctcaacccctgcttgactacttccagccggtctaccggtggttgcgggaacagaac
gagcgtcacggggaggtgctgggatggccggaataccagtggcggccaccgatgcccaat
aattacccacaggacatcggactggtgaccgatgaggttgaggccagaaggtttgtggag
gaatatgaccggagatcccaggtgatatggaacgaatatgccgaggctaactggaactat
aacaccaacatcaccacagaggccagcaagattctgctgcagaagaacatacagatggca
aaccacaccttcaagtttggcacctgggccaggcagttcgatgtgactaacttccagaat
gccagcatcaagcggatgataaagaagattcaggacctagagcgagcagcgctgcctgcc
aaggagctggaggagtacaaccagatcctgctggacatggaaaccacctacagtgtggcc
tctgtctgccacaccaacggcacctgtctgcagctggagcctgatgtgacgaatctcatg
gccacatcccggagatatgaagacctgctgtgggcctggaagggctggcgagacaaggtg
gggagagccatcctcccttccttccccaaatatgtggaacttgccaacaaggctgcccgg
ctcaacggctacgaggatgcaggggactcctggagggtcatgtacgagatcccgtccctg
gagcaagatctggagcagctttaccaggagctgcagccgctctacctgaacctgcacgcc
tacgtgcgccgggccctgcaccgccactacgggccccagcacatcaacctggagggcccc
attcccgctcacctgctggggaacatgtgggctcagacctggtccaacatctatgacttg
gtggtgcccttcccttcagcccccaagatagatgccacagaggccatgataaagcagggc
tggacacccaaaaggatgtttgaagaagcggacaatttcttcacctccctggggctgttg
cccgtgccctttgagttctggaacaagtcaatgctggagaagccgactgacgggcgggag
gtagtgtgccatgcctctgcctgggacttctacaatggcaaggacttcaggatcaaacag
tgcaccaccgtgaacatggaggacctggtggtggcccatcatgaaatgggccacatacag
tatttcatgcagtacaaggacttgcctgtaaccttccgggagggtgccaaccctggcttt
catgaggccattggagatgtgctggcgctctctgtgtctacccccaagcacctacacagt
atcaacctgctgagtagcgagagtggcggctacgagcaagacatcaattttctgatgaag
atggcactcgacaagatcgcctttgtccccttcagctacctggttgaccagtggcgttgg
agggtattcgatggaagcatcaccaaggagaactacaaccaggagtggtggaacctcagg
ctgaagtaccagggcctctgccccccagtgccccggtctcaaggtgactttgacccaggg
gccaagttccacgttccttccaatgtgccttatatcaggtacttcgttggctttgtcatt
cagttccagttccacgaggctctgtgtcaggcggctggccacaatggccccttgcacacg
tgtgacatctaccactctaaggaggcagggaagcgcctggcggatgccatgaaactaggc
ttcagtaagccgtggccagaagccatgaagctgatcactggccagtccaacatgtctgcg
tcagccatgatgaactacttcaagccgctgctggactggctcctcaccgagaacaggcgg
catggggagaagctgggctggcctcagtacaactggacgcccacctccgctcgctcggaa
ggccccttcccgggcaccggccgcgtcagcttcctgggcctggacctggaggagcagcag
gcccgcgtgggccagtgggtgcttctcttcctgggcgtcgccctgctggtggccaccttg
ggcctcacccagcggctcttcagcatccgccaccacagcctccgccagccccaccgtggg
ccccagtttggctccgaggtggagctgagacactcctga

DBGET integrated database retrieval system