KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377629
Entry
101377629         CDS       T05148                                 

Gene name
EGF
Definition
(RefSeq) LOW QUALITY PROTEIN: pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro04010  MAPK signaling pathway
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04020  Calcium signaling pathway
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04072  Phospholipase D signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04510  Focal adhesion
oro04540  Gap junction
oro04630  JAK-STAT signaling pathway
oro04810  Regulation of actin cytoskeleton
oro05160  Hepatitis C
oro05165  Human papillomavirus infection
oro05200  Pathways in cancer
oro05210  Colorectal cancer
oro05212  Pancreatic cancer
oro05213  Endometrial cancer
oro05214  Glioma
oro05215  Prostate cancer
oro05218  Melanoma
oro05219  Bladder cancer
oro05223  Non-small cell lung cancer
oro05224  Breast cancer
oro05226  Gastric cancer
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101377629 (EGF)
   04012 ErbB signaling pathway
    101377629 (EGF)
   04014 Ras signaling pathway
    101377629 (EGF)
   04015 Rap1 signaling pathway
    101377629 (EGF)
   04630 JAK-STAT signaling pathway
    101377629 (EGF)
   04066 HIF-1 signaling pathway
    101377629 (EGF)
   04068 FoxO signaling pathway
    101377629 (EGF)
   04020 Calcium signaling pathway
    101377629 (EGF)
   04072 Phospholipase D signaling pathway
    101377629 (EGF)
   04151 PI3K-Akt signaling pathway
    101377629 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101377629 (EGF)
   04540 Gap junction
    101377629 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101377629 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101377629 (EGF)
   05231 Choline metabolism in cancer
    101377629 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101377629 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101377629 (EGF)
   05212 Pancreatic cancer
    101377629 (EGF)
   05226 Gastric cancer
    101377629 (EGF)
   05214 Glioma
    101377629 (EGF)
   05218 Melanoma
    101377629 (EGF)
   05219 Bladder cancer
    101377629 (EGF)
   05215 Prostate cancer
    101377629 (EGF)
   05213 Endometrial cancer
    101377629 (EGF)
   05224 Breast cancer
    101377629 (EGF)
   05223 Non-small cell lung cancer
    101377629 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101377629 (EGF)
   05165 Human papillomavirus infection
    101377629 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101377629 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101377629 (EGF)
Cytokines and growth factors [BR:oro04052]
 Growth factors
  Growth factors (RTK binding)
   101377629 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF DUF5050 EGF_3 EGF_MSP1_1 Plasmod_Pvs28 Tme5_EGF_like
Other DBs
NCBI-GeneID: 101377629
NCBI-ProteinID: XP_012421659
UniProt: A0A2U3ZRP9
LinkDB
Position
Unknown
AA seq 1210 aa
MLLFLIILLPVVFKCSFASLSVLERWNCPGGSPPGKGNSTCVGPAPFLIFSHGSSIFRID
LEGTNHEQLVADAGVSVIMDFHYNKGRIYWVDLERQLLQRVFLNGTRQERVCNIEKNVSG
MAINWINEELIWSNQQEGIITVTDMKGNNSRVLLSALNYPANVAIDPVERFIFWSSEVAG
SLHRADLNGVEEKILLETTERITAVSLDVLDKRLFWIQYNRDGSNSYICSCNYDGGSVHF
SKHLTQHNLFAMSLFGDRIFYSIWKKKTIWIADKHTGKDMVRIKLDPSFVPPVGIKVVHP
LLQPKAESDAWARDQKPCKWRKGNCRGSMCGQDSKSHLCTCAEGYTLSQDGKYCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFILLPDGKRCHQLISCPSNTSKCSHDCVLTSDGPV
CFCPEGSVLETDGKTCSGCSSPDNGGCSQVCLPLSPVSWECGCFPGYDLQLDKKSCVASG
PQPFLLFANSQDIRHMHFDGTDYRTLLSQQMGMVFALDHDPVENKIYFAHTTLKWIERAN
RDGSQRERLTEEAVDMPEGLAIDWIDRKFYWTDRGKSLIEGSDLNGKHREIIIKEDISQP
RGIAVHPMSKRLFWTDMGINPRIESSSLQGIGRLVIASSDLVWPSGITIDYFTDKLYWCD
AKLSVIEMANLDGSKRQRLAQNDVGHPFAVAVFEDHVWFSDWTMPSVIRVNKRTGKNRVR
LRGSMLKPSSLIVVHPLAKPGAQPCLHQNGGCEHICQERFGTAQCLCREGFVKAPDGKAC
LALNGHQIPSLGSEADQVMPLDVLSRKRGFEDNITESQHLLVAEIMVSDADDCGPVGCST
RAQCVSEGENATCQCLKGFTGDGKLCFDIDECETGITVCPPTSKCVNTEGGYVCRCLEGY
RGDGIHCLDINECRLGMHTCGENATCTNTEGNYTCMCAGSLSEPGRICTDSTSPSHLMED
GHHSVRNGYRECPSAYDGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDLKWELRHV
GQGRQQQVTVVAIGVVGLVLLLLLGLWGAHCYRTKKLPSKNLKNPDEESSREVCSSRPTD
SEARMASCPQPWFVVLKEHPNLRNGSQPVALKDGEAADVSQFSSPEPGSVQRLSWRNEAQ
MYVGTEQGCRTPPPSDRASGPQAMKQSSSLPSCGAQPIALGVEKPHSLLSAXPLLQQRAP
EPPYQKKLTR
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgctgctcttcctaatcattctgttgccggtagtttttaaatgtagttttgctagtctc
tcagtcctggaacgatggaactgtcctggaggatctcccccaggaaaggggaattctact
tgtgtgggtcctgcacccttcttaattttctcccatggaagcagtatcttcaggattgac
ctggaaggaactaatcatgagcaactggtggcagatgctggtgtatcagtgatcatggat
tttcattacaataagggaagaatctattgggtagatctagaaagacaacttttgcaaaga
gtttttctgaatgggacaaggcaagagagagtatgcaacatagagaaaaatgtttcagga
atggcaataaattggataaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaacaattcccgagttctcttaagtgccttaaactatcct
gcaaatgtagcaattgatccagtagaaaggtttatattttggtcttccgaggtggctggc
agccttcacagagcagatctcaatggtgtggaagagaagattctgttagagacgacagaa
agaataacagctgtgtcactggatgtgcttgataaacggcttttttggattcagtacaac
cgagatggaagcaattcttatatttgttcctgtaattatgatggaggttctgtccatttt
agcaaacatcttacacagcacaatttgtttgcaatgtccctttttggtgatcggatcttc
tattcaatatggaaaaagaagacaatttggatagctgacaaacacaccgggaaggatatg
gttagaattaagctcgacccatcatttgtaccacctgttggaatcaaagtagtgcatcca
ctcttacagcccaaggcagagagtgatgcttgggcacgtgatcagaaaccctgcaaatgg
aggaaaggtaactgcagaggtagcatgtgtggtcaagactcgaagtcccatttgtgcacg
tgtgcggagggatatactttaagccaagatggaaagtactgtgaagatgtcaatgaatgt
gccttttggaatcatggatgtactcttggatgtgaaaacatccctggatcttattattgc
acatgtcctgtaggttttattctgcttcctgatgggaaacggtgtcatcaattaatttcc
tgtccaagcaatacatccaaatgtagccatgactgtgttctgacatcagatggtcccgta
tgtttctgtcctgagggctcagtgcttgagacagatggaaaaacatgtagtggctgttca
tcacctgataatgggggatgtagccaggtctgcctccctctaagcccagtctcctgggaa
tgtggttgctttcctgggtatgatctacaactggacaaaaaaagctgtgtggcatcagga
ccacagccatttttactgtttgccaattctcaagatattcgacacatgcattttgatgga
acagattatagaaccctgctcagccagcaaatgggaatggtttttgcccttgatcacgac
cccgtggaaaataagatatacttcgcccatacaaccctgaagtggatagagagagctaat
agggatggttcccagcgagaaaggcttactgaggaagcagtagatatgccagaaggtctt
gccatcgattggattgaccgtaaattctactggacggacagagggaaatctctcatcgaa
gggagtgatttaaatggaaaacatcgtgaaataatcattaaggaggacatctctcagcca
cgaggaattgctgtccatccaatgtccaagagattattctggactgatatggggattaat
ccacgaattgaaagttcttcccttcaaggcattggccgactggttatagctagttctgat
ctggtctggcccagtggaataacaattgattattttactgacaaattgtattggtgtgat
gccaagctgtctgtgatcgaaatggccaatctggatggttcaaaacgccaaagacttgcc
cagaacgatgtagggcacccatttgctgtggctgtgtttgaggatcatgtgtggttctcg
gattggacaatgccatcagtaataagggtgaacaagaggactggcaaaaatcgggtacgt
ctccgaggcagcatgctgaagccttcatcactgattgtagttcatccattggcaaaacca
ggagcacagccctgcttacatcaaaatggaggctgtgaacatatttgccaagagaggttt
ggaactgctcagtgtttgtgtcgtgaaggttttgtgaaagccccagatgggaaagcgtgt
ctggctctgaatggccatcagatcccttcactaggtagtgaagcagatcaagtaatgcca
ttggatgtcttatccaggaagagaggatttgaagataacattacagaatctcagcatttg
ctagtggctgaaatcatggtatcagatgctgatgactgtggtcctgtgggatgcagtaca
cgggctcagtgtgtttcagagggagaaaatgccacatgtcagtgtttgaaaggatttact
ggggatggaaaactatgttttgatatagatgaatgtgagacgggcatcacagtttgccct
cccacctccaagtgcgtcaatactgaaggtggctatgtctgccggtgcttggaaggctac
cgaggtgatggaattcactgtcttgatattaatgagtgccgattgggcatgcacacttgt
ggggagaatgccacctgtacaaatacggagggaaactacacctgcatgtgtgccggcagc
ctgtctgaacctgggcggatatgcactgactctacgtccccttctcatctcatggaggat
ggccaccattctgtgagaaatggttaccgggaatgcccctcagcctatgacggctattgc
ctctataacggtgtgtgtatgtacatcgaagcagttgacagatacgcatgcaactgtgtc
tttggctacgtcggggagcgatgtcagcaccgagacttgaaatgggaactgcgccacgtt
ggccaggggaggcagcagcaagtcaccgtggtggccatcggcgtggtggggctcgtcctg
ctgctgctgctggggctgtggggggctcactgctacaggactaagaagctgccatcaaaa
aatttaaagaatccagatgaagagtcgagcagagaagtttgcagtagcaggcctacagac
agcgaggccaggatggcctcgtgtccccagccctggtttgtggtgctaaaggaacaccca
aatctcaggaatggaagtcaacctgtggcccttaaggatggtgaggcagcagatgttagc
cagttctcctctccggagccaggctcagtgcaacggctgtcatggagaaatgaagcccag
atgtatgtgggcacagagcaaggctgccgcactccaccacccagtgacagagcctctggt
ccccaggcaatgaagcagagctcttctctcccctcctgtggggcacagcccattgctttg
ggggttgagaagccacattctctcctgtcagctnaacccttactgcaacaaagggcccca
gagccaccataccaaaagaagctgactcggtga

DBGET integrated database retrieval system