KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377851
Entry
101377851         CDS       T05148                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 isoform X1
  KO
K05405  interleukin 6
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01521  EGFR tyrosine kinase inhibitor resistance
oro01523  Antifolate resistance
oro04060  Cytokine-cytokine receptor interaction
oro04061  Viral protein interaction with cytokine and cytokine receptor
oro04066  HIF-1 signaling pathway
oro04068  FoxO signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04218  Cellular senescence
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04623  Cytosolic DNA-sensing pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro04657  IL-17 signaling pathway
oro04659  Th17 cell differentiation
oro04668  TNF signaling pathway
oro04672  Intestinal immune network for IgA production
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro05010  Alzheimer disease
oro05020  Prion disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05132  Salmonella infection
oro05133  Pertussis
oro05134  Legionellosis
oro05135  Yersinia infection
oro05142  Chagas disease
oro05143  African trypanosomiasis
oro05144  Malaria
oro05146  Amoebiasis
oro05152  Tuberculosis
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05202  Transcriptional misregulation in cancer
oro05321  Inflammatory bowel disease
oro05323  Rheumatoid arthritis
oro05332  Graft-versus-host disease
oro05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101377851 (IL6)
   04668 TNF signaling pathway
    101377851 (IL6)
   04066 HIF-1 signaling pathway
    101377851 (IL6)
   04068 FoxO signaling pathway
    101377851 (IL6)
   04151 PI3K-Akt signaling pathway
    101377851 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101377851 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101377851 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101377851 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101377851 (IL6)
   04620 Toll-like receptor signaling pathway
    101377851 (IL6)
   04621 NOD-like receptor signaling pathway
    101377851 (IL6)
   04623 Cytosolic DNA-sensing pathway
    101377851 (IL6)
   04625 C-type lectin receptor signaling pathway
    101377851 (IL6)
   04659 Th17 cell differentiation
    101377851 (IL6)
   04657 IL-17 signaling pathway
    101377851 (IL6)
   04672 Intestinal immune network for IgA production
    101377851 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101377851 (IL6)
   05202 Transcriptional misregulation in cancer
    101377851 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101377851 (IL6)
   05321 Inflammatory bowel disease
    101377851 (IL6)
   05332 Graft-versus-host disease
    101377851 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101377851 (IL6)
   05020 Prion disease
    101377851 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    101377851 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101377851 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101377851 (IL6)
   04931 Insulin resistance
    101377851 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101377851 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101377851 (IL6)
   05135 Yersinia infection
    101377851 (IL6)
   05133 Pertussis
    101377851 (IL6)
   05134 Legionellosis
    101377851 (IL6)
   05152 Tuberculosis
    101377851 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101377851 (IL6)
   05161 Hepatitis B
    101377851 (IL6)
   05171 Coronavirus disease - COVID-19
    101377851 (IL6)
   05164 Influenza A
    101377851 (IL6)
   05162 Measles
    101377851 (IL6)
   05168 Herpes simplex virus 1 infection
    101377851 (IL6)
   05163 Human cytomegalovirus infection
    101377851 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101377851 (IL6)
   05169 Epstein-Barr virus infection
    101377851 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101377851 (IL6)
   05144 Malaria
    101377851 (IL6)
   05142 Chagas disease
    101377851 (IL6)
   05143 African trypanosomiasis
    101377851 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101377851 (IL6)
   01523 Antifolate resistance
    101377851 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101377851 (IL6)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101377851 (IL6)
SSDB
Motif
Pfam: IL6 IL11 GCSF IL23
Other DBs
NCBI-GeneID: 101377851
NCBI-ProteinID: XP_004397376
UniProt: A0A2U3VQB3
LinkDB
Position
Unknown
AA seq 212 aa
MNSFSASAFSPVAFSLGLLLVMATAFPTPGPVGGESQADATSNRPPLTSPDKMEEFIKYI
LGKISALRKEMCDKYNKCEDSKEALAENNLHLPKLAEKDGCFQSGFNQETCLTRIATGLL
EFQTHLKYLQANYEGNKENANSVYISTKLLLQMLMRKVKSQDEVTTPDPTIDTSLQTILK
AQDKWLKHTTIHLILRSLEDFLQFSLRAVRIM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactccttctccgcaagcgccttcagtccagtcgccttctccctggggctgctcctg
gtgatggctactgcttttcctaccccgggacctgtgggaggagagtcccaagctgatgcc
acctcaaatagaccaccactcacctctccagacaaaatggaagaattcattaagtacatc
ctcggcaaaatctctgcactgagaaaggagatgtgtgacaagtataacaagtgtgaagac
agcaaggaggcactggcagaaaacaacctacatcttccgaagctggcagaaaaggacggg
tgcttccaatctgggttcaaccaggagacctgcctgacaagaatcgctaccggtcttctg
gagtttcagacacacctgaaatacctccaggccaactatgagggtaataaggaaaatgcc
aactctgtgtacatcagtaccaaactcctgctccagatgctgatgagaaaggtaaagagt
caggatgaagtgaccacccctgaccccaccatagacaccagcctgcagactatcctgaag
gcgcaggacaagtggctgaagcacacaacaattcacctcatcctgcggagccttgaggat
ttcctgcagttcagcctgagggctgttcggatcatgtag

DBGET integrated database retrieval system