KEGG   Odobenus rosmarus divergens (Pacific walrus): 101377969
Entry
101377969         CDS       T05148                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04151  PI3K-Akt signaling pathway
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101377969 (CSF3R)
   04151 PI3K-Akt signaling pathway
    101377969 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101377969 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101377969 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101377969 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oro04050]
    101377969 (CSF3R)
   04090 CD molecules [BR:oro04090]
    101377969 (CSF3R)
Cytokine receptors [BR:oro04050]
 Interleukin receptor families
  Prolactin receptor family
   101377969 (CSF3R)
CD molecules [BR:oro04090]
 Proteins
  101377969 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind ObR_Ig Tissue_fac fn3_2
Other DBs
NCBI-GeneID: 101377969
NCBI-ProteinID: XP_004402711
UniProt: A0A2U3W3V5
LinkDB
Position
Unknown
AA seq 839 aa
MAGPGTWSLPVATVIILLLPRSLEECGRISLPTPTVHLGDPITASCIISPNCSHLDPESQ
ILWKLGTELRPGKRQRRLADGRQESTITVPRLDSPWVLLSCCLRWGNSLQILDQAEVQAG
YPPAAPHNLSCLMNLTTNSLICQWEPGPNNHLPTNFTLKSFKSRGYCQTQEDTVPDCVPN
DGQNHCSIPRRHLQLYQNMGIWVQAENALGTSKSSQLCLVPMDVVKLEPPTLWALAPSPE
VAAPQPGCLLLHWEPWKPSLYIEQKCELRHQPQLAEASWALVGPLLSQTLQYELCGLLPS
TAYVLQMRCTRWPLPGQWSDWSPSLTLTTTQQAPIVTLDTWWRQRQLDPRTAAVQLFWKP
MPLDKYSGQIQGYLVRAPDQAEADPPLCNTTELSCTFHLPSETQEVVLMAYNTAGTSHPS
PVVFLESRGLPLARLHTMARDPHSLWVGWEPPSPRPQGYVIEWGLGPPSPSGSNKSWKME
HNGSISGTLLQENIRPFQLYEITVTPLYQDTMGPSQHIYAYSQEMAPSHAPELHLKHIGK
TWAQLEWVPQAPELGKSPLTHYTVFWTNAQDQSFSTVLNASSHGLVLRGLEPASLYHVHL
MATSKAGAANSTSLTLMTLALEESELHVLLGLFGFLLLFTCLCGAARFCCRPSRKNPLWP
SVPDPAHSSLGSWVPTIMVEETFQLPSLRDSGMPPITKITVLEEEEKKPGPWESSDSSGT
CGLPTLVQAYVLQGDPRAPSTQPQPPSITSDQVLYGKVLGSPTGPGPRHYLRCDSAQPLL
GGLTPSPQFYENLWFQTSPLGTPEPLIPNQEDDCVFGPLLDFPLLQGLQVHGVEGLGGV
NT seq 2520 nt   +upstreamnt  +downstreamnt
atggcagggccgggaacctggagcctgcccgtggccaccgtgattatcctgctgctcccc
agaagcctggaggagtgtgggcgcatcagcctcccaacccccactgtccacctgggggac
cccatcacagcctcctgcatcatcagcccgaactgcagccacctggaccccgagtcacag
attctgtggaaattgggaacagagcttcgacccggaaagaggcagcggcgtctggcggat
ggaaggcaggaatccaccatcaccgtgccccgcctcgacagcccatgggtccttctctcc
tgctgcctgcgctggggcaacagcctgcagatcctggaccaggctgaggtgcaggcaggc
taccctcccgctgcaccccacaacctgtcctgcctcatgaacctcacaaccaacagcctc
atctgtcagtgggagccaggacccaacaaccacctgcccaccaacttcaccctcaagagc
ttcaagagccggggctactgtcagacccaagaggacactgtccccgactgcgtgcctaac
gacggccagaaccactgctccatcccgcgcagacacctgcagttgtaccagaacatgggc
atctgggtgcaggcagagaacgcgctagggaccagcaagtcctcacagttgtgcctcgtt
cccatggatgtcgtgaagctggagccccccacactgtgggccctggcccccagccctgag
gtggctgcgccccagccaggttgtctgctgttgcactgggagccatggaagccaagcctg
tacatagaacagaaatgtgagctgcgccaccagccacagcttgcagaagccagctgggcc
ctggtgggccccctgctctcccagaccctccagtatgagctctgcgggctcctcccatcc
acagcctatgtcctgcagatgcgctgcacccgctggcccctgcctggccagtggagcgac
tggagccctagcctgacgctgaccaccacgcaacaggcccccatcgtcacactggacaca
tggtggcggcagagacagctggaccccaggacggcagccgtgcagctgttctggaagcca
atgcccttggacaaatacagcgggcagatccaaggctacctggtcagagctccagaccag
gctgaggcagatccccccctctgcaacaccacggagctaagctgcaccttccacttgccc
tcggaaacccaggaggtggtccttatggcctataacacagctgggacctctcatcccagc
ccagtggtcttcctggagagcagaggcctgcccctggccagactccacaccatggctcga
gatccccacagcctctgggtgggctgggaaccccccagccctcggcctcagggctatgtg
attgagtggggcctggggccccccagccccagtggcagcaataagagctggaagatggag
cataacggaagcatttctgggaccctgctgcaggagaacatcaggccctttcagctctac
gagatcactgtgacccccctctaccaggacaccatgggaccctcccagcacatctatgcc
tactcccaagagatggccccctcccacgccccagagctgcatctaaagcacattggcaag
acctgggcccagctggagtgggtgccccaggcccccgagctggggaagagcccccttacc
cactacaccgtcttctggacgaatgctcaggaccagtccttctccactgtcctgaatgcc
tcctcccacggcttggtcctccgcggcttggagcctgccagcttgtaccatgtccacctc
atggctaccagcaaggccggggccgccaacagtacaagccttaccctgatgaccttggcc
ctagaggagtctgagctgcatgtcctcctgggcctatttggcttcctactcttgttcacc
tgcctctgtggggcggcccggttctgctgcagacccagcaggaagaatcccctctggcca
agtgtcccagacccagcccacagcagcctgggctcctgggtgcctaccatcatggtggag
gagaccttccagctgcccagccttcgggactccggcatgccacccatcaccaagatcacg
gtgctggaggaagaagagaagaagccagggccctgggagtccagtgacagctcagggacc
tgtggcctccccaccctggtccaggcctatgtgctccagggggacccacgagcaccttcc
acccagccccagcccccgtcgatcaccagtgaccaggtcctttacgggaaggtgctgggc
agccccacaggcccaggtccaaggcactacctccgctgtgactctgctcagcccctccta
gggggccttactcccagcccccagttttatgagaacctctggttccagactagccccctg
gggaccccagagcccctcatcccaaaccaggaggatgactgtgtcttcggaccattgctt
gacttccccctcctgcaagggctccaagtccatggggtggaggggctagggggcgtctag

DBGET integrated database retrieval system