KEGG   Odobenus rosmarus divergens (Pacific walrus): 101378334Help
Entry
101378334         CDS       T05148                                 

Definition
(RefSeq) cationic trypsin-like isoform X1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04080  Neuroactive ligand-receptor interaction
oro04972  Pancreatic secretion
oro04974  Protein digestion and absorption
oro05164  Influenza A
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101378334
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    101378334
   04974 Protein digestion and absorption
    101378334
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    101378334
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oro01002]
    101378334
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101378334
Enzymes [BR:oro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101378334
Peptidases [BR:oro01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101378334
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101378334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 101378334
NCBI-ProteinID: XP_004416603
UniProt: A0A2U3X3I1
LinkDB All DBs
Position
Unknown
AA seq 263 aa AA seqDB search
MDEKCSSLSPVQIQGSTMKTFIFLALLGATVAFPIDDDDKIVGGFTCQKNSVPYQVFLNL
GYLFCGGSLINSQWVVSAAHCYKSQIQVHLGEHKITVYEGGEQFINSAKVIRHPKYNEKT
FDNDIMLIKLSSPATLNSRVSAVSLPKSCAAAGTQCLISGWGNIQSIGEKFPDALRCLQV
PILSDSTCRNAYPGRISSKMICLGYLQGKKDACQGDSGGPVVCNRELQGIVSWGIGCAQK
GKPGVYTKVCKYVKWIRQTIADN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggatgagaaatgttcatcactttccccagtccagatccagggatcaacgatgaagacc
ttcatcttccttgccctgctgggagccactgttgctttccccattgatgatgatgacaag
atcgttgggggcttcacctgtcagaagaattctgtcccctaccaggtgttcctgaacttg
ggctacctcttctgtggtggctccctcatcaattcccagtgggtggtgtccgcagctcac
tgctacaagtcccaaatccaggtgcatctgggagaacacaaaatcacagtctatgagggt
ggtgagcaattcatcaattcagccaaggtcatccgccaccccaaatacaatgaaaaaact
tttgataatgacatcatgctgattaaactgagttcgcccgccaccctcaactctcgagtg
tctgctgtctctctgccaaaatcctgtgcagctgctggtacccagtgcctcatctctggc
tgggggaatatccagagtattggggaaaagtttcctgatgccctgcggtgtcttcaagtg
cccatcctctctgacagcacttgccgcaatgcctaccctggcaggatcagcagcaaaatg
atctgtctgggctacctgcagggtaaaaaggacgcttgccagggtgactctggtggccct
gtggtctgcaacagagagctccagggcattgtctcctggggtatcggctgtgctcaaaag
ggcaaacctggtgtctacaccaaggtctgcaaatatgtgaagtggattcggcaaaccatt
gctgacaactaa

DBGET integrated database retrieval system