KEGG   Odobenus rosmarus divergens (Pacific walrus): 101378353
Entry
101378353         CDS       T05148                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01524  Platinum drug resistance
oro03320  PPAR signaling pathway
oro04068  FoxO signaling pathway
oro04071  Sphingolipid signaling pathway
oro04140  Autophagy - animal
oro04150  mTOR signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04152  AMPK signaling pathway
oro04210  Apoptosis
oro04510  Focal adhesion
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04722  Neurotrophin signaling pathway
oro04910  Insulin signaling pathway
oro04919  Thyroid hormone signaling pathway
oro04931  Insulin resistance
oro04960  Aldosterone-regulated sodium reabsorption
oro05145  Toxoplasmosis
oro05205  Proteoglycans in cancer
oro05213  Endometrial cancer
oro05215  Prostate cancer
oro05223  Non-small cell lung cancer
oro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101378353 (PDPK1)
   04071 Sphingolipid signaling pathway
    101378353 (PDPK1)
   04151 PI3K-Akt signaling pathway
    101378353 (PDPK1)
   04152 AMPK signaling pathway
    101378353 (PDPK1)
   04150 mTOR signaling pathway
    101378353 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101378353 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    101378353 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101378353 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101378353 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    101378353 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101378353 (PDPK1)
   03320 PPAR signaling pathway
    101378353 (PDPK1)
   04919 Thyroid hormone signaling pathway
    101378353 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101378353 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101378353 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101378353 (PDPK1)
   05231 Choline metabolism in cancer
    101378353 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101378353 (PDPK1)
   05213 Endometrial cancer
    101378353 (PDPK1)
   05223 Non-small cell lung cancer
    101378353 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101378353 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101378353 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101378353 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101378353 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101378353 (PDPK1)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101378353 (PDPK1)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   101378353 (PDPK1)
Membrane trafficking [BR:oro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    101378353 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo YukC
Other DBs
NCBI-GeneID: 101378353
NCBI-ProteinID: XP_004403239
UniProt: A0A2U3W585
LinkDB
Position
Unknown
AA seq 558 aa
MARTTSQLYDTVPIQSSVVLCACPSPSMVRTQTESGIAPGIPTGGSRQGPTMDSTAAESR
PSTNSLQHTTQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI
IKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFD
ETCTRFYTAEMVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQAR
ANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKARDLVEKLLVLDATKRLGCEEMGGYGPLRAHPFFESITWENLQHQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDAGLPQMAGSNIEQYIHD
LDTNSFELDLEFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLL
TEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKK
IQEVWRHRYQSHPDAAVQ
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacactgttccaattcagtccagcgtggtgtta
tgtgcttgcccgtccccatcaatggtgaggacccagactgagtccggcatagcccctggc
attcccaccggtggtagcagacagggccccaccatggacagcactgcggccgagtcccga
ccgagcaccaactcgctgcagcacaccacacagccgccaccacagcctcggaagaaacgg
cctgaagacttcaagtttgggaaaattcttggtgaaggctctttttctacagttgtcctg
gcccgagaactggcaacctcaagggaatatgctattaaaattctagagaaacgtcacatt
atcaaagagaacaaagtcccgtatgtaaccagagagagagacgtgatgtcacgcctggat
cacccgttctttgttaaactttacttcacatttcaggatgatgaaaagttgtactttggt
cttagttatgccaaaaatggagaactccttaaatacattcgcaaaattggctcattcgat
gagacgtgcacccggttttacacggccgagatggtgtcagctctggagtacttgcatggc
aagggcatcattcacagggacctgaaaccggaaaacattttgttaaatgaagacatgcac
atccagatcacagatttcggaacagcaaaagtactatccccggagagtaaacaagccagg
gccaactcgtttgtaggaacagcccagtatgtgtctccagagctgctcacggagaagtcg
gcctgtaaaagttcagacctttgggctctcggatgtataatataccagcttgtggcagga
ctgccgccttttcgagcgggaaatgaatatcttatatttcagaagatcattaagttggaa
tatgactttcctgaaaaattcttccctaaggcaagagaccttgtggaaaaacttttggtt
ttagatgccacgaagcgattaggctgtgaggaaatgggagggtacggacccctgcgagct
catccgttcttcgagtccatcacgtgggagaacctgcagcatcagacgcctccgaagctc
actgcctacctgccagccatgtcagaggatgacgaggactgctacggaaactacgacaac
ctcctgagccagttcggctgcatgcaggtgtcctcgtcctcctcctcccactccctgtcc
gcctcggatgcaggcctgccgcagatggcgggcagcaacatcgagcagtatatccatgac
ctggacactaattcttttgaactggacttagagttctccgaagatgagaagaggttgtta
ctggagaagcaggccagtggaaacccttggcaccagtttgtagaaaataacttaatacta
aagatgggtcccgtagataagcggaagggcttgtttgcacgacgacgacagttactgctc
acggaagggccacacttgtattacgtggatcctgtcaacaaagtcctgaaaggcgaaatt
ccatggtcacaagaactccgaccggaggccaagaactttaaaaccttcttcgtgcacacg
ccgaacaggacgtattacctgatggacccgagtgggaatgctcacaaatggtgcaaaaag
atccaagaagtgtggagacacagataccagagccacccagatgctgctgtgcagtga

DBGET integrated database retrieval system