KEGG   Odobenus rosmarus divergens (Pacific walrus): 101378506
Entry
101378506         CDS       T05148                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04061  Viral protein interaction with cytokine and cytokine receptor
oro04144  Endocytosis
oro04151  PI3K-Akt signaling pathway
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro05162  Measles
oro05166  Human T-cell leukemia virus 1 infection
oro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101378506 (IL2RA)
   04151 PI3K-Akt signaling pathway
    101378506 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101378506 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101378506 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101378506 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101378506 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    101378506 (IL2RA)
   04659 Th17 cell differentiation
    101378506 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101378506 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101378506 (IL2RA)
   05162 Measles
    101378506 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oro04050]
    101378506 (IL2RA)
   04090 CD molecules [BR:oro04090]
    101378506 (IL2RA)
Cytokine receptors [BR:oro04050]
 Interleukin receptor families
  IL2 receptor family
   101378506 (IL2RA)
CD molecules [BR:oro04090]
 Proteins
  101378506 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 101378506
NCBI-ProteinID: XP_012421838
UniProt: A0A2U3ZS71
LinkDB
Position
Unknown
AA seq 422 aa
MFGTCAFRRRQHPESPDPRPRKEVTCPLSAPRAQEGGHKGAGPQAARPDAASGATYPARP
ADSPHGPRRRTGAEAPRRGRAGRTQRKPATARPEPAPTPTPSPQGARRRGVRERVRPGER
HACVCAAGRFAAATPAGGRTALHLPSSGVLLSRHEGSQWPEFVKFQTRESLAVTPDDLCD
DDPPNLKHATYKALEYKTGTMLNCRCERGFRRLSNFMRCAGNSSHASWENKCQCISTSSK
STEGQVTPKPKEQEMQSQTPPMDQGNLPGHCREPPSWEHEDSKRIYHFVVGQTVRYQCAQ
GFRALRRGSAESVCKTISGKTQWTQPQVKCISERNNGWFPDDEEEPQASTHAPPGRDTSC
PLVTTSATDFHKHTEVATTMESFIFTTEYQIAVAGCIVLLISVLLLSGLTWRRRWRKRRR
TI
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgtttggtacctgcgcctttcggagacgtcaacatccggagtcccccgacccgcggccc
cggaaggaagtgacttgccccctctccgctccccgggcccaggagggggggcacaagggt
gctgggccacaggccgcccgtccggacgccgcctcgggcgccacttacccggcccgcccg
gccgactctccccatgggccgcggcggcgcaccggggccgaggcgccgcggagagggcgg
gctgggcgtactcagcgtaagcccgcgaccgcaagacctgaaccggcgccaacccctacg
ccgagtccgcagggcgcgcggcggcgcggggtcagggagcgcgtgcggccgggagagagg
cacgcctgcgtctgcgccgcgggccgctttgccgcggcgacccctgccggcgggaggacc
gcactgcacctcccctcctccggcgtccttctctcccgccatgaggggtcgcagtggccc
gagtttgtgaaatttcagactcgggagagcctagcagtgaccccagatgacctctgtgat
gatgacccgccaaacctcaagcacgccacatacaaagctctcgaatacaagacgggcaca
atgttaaactgcagatgtgagagaggcttccgcagactaagcaacttcatgcgttgtgca
ggaaactctagccacgcttcctgggaaaacaaatgccagtgcataagtacatcctccaag
agcacagaaggacaagttactcctaaacccaaagaacaggaaatgcagagccaaacgccg
cccatggaccaaggtaaccttccaggtcactgcagggagcctccttcctgggagcatgaa
gattcaaagagaatctaccactttgtggtggggcagacggttcgctaccagtgcgcgcag
ggattcagggccctgcggagaggttctgccgagagcgtctgcaaaaccatctcagggaag
acccagtggacacagccccaggtcaagtgcataagtgaaaggaataacggttggtttcca
gatgacgaagaagagcctcaagcaagcacccatgctcctcctgggagagacacttcctgt
cccttggtaacaacaagtgctacagatttccacaagcacacagaagtggctaccaccatg
gagtcattcatattcacaaccgagtatcagatagcagtggccggctgcattgtcctgctc
atcagcgtcctccttctgagcgggctcacctggcggcggagatggaggaagcgtagaaga
acaatctag

DBGET integrated database retrieval system