KEGG   Odobenus rosmarus divergens (Pacific walrus): 101378737
Entry
101378737         CDS       T05148                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04015  Rap1 signaling pathway
oro04310  Wnt signaling pathway
oro04390  Hippo signaling pathway
oro04510  Focal adhesion
oro04520  Adherens junction
oro04550  Signaling pathways regulating pluripotency of stem cells
oro04670  Leukocyte transendothelial migration
oro04916  Melanogenesis
oro04919  Thyroid hormone signaling pathway
oro04934  Cushing syndrome
oro05010  Alzheimer disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05100  Bacterial invasion of epithelial cells
oro05132  Salmonella infection
oro05160  Hepatitis C
oro05163  Human cytomegalovirus infection
oro05165  Human papillomavirus infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05200  Pathways in cancer
oro05205  Proteoglycans in cancer
oro05210  Colorectal cancer
oro05213  Endometrial cancer
oro05215  Prostate cancer
oro05216  Thyroid cancer
oro05217  Basal cell carcinoma
oro05224  Breast cancer
oro05225  Hepatocellular carcinoma
oro05226  Gastric cancer
oro05412  Arrhythmogenic right ventricular cardiomyopathy
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101378737 (CTNNB1)
   04310 Wnt signaling pathway
    101378737 (CTNNB1)
   04390 Hippo signaling pathway
    101378737 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101378737 (CTNNB1)
   04520 Adherens junction
    101378737 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101378737 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101378737 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101378737 (CTNNB1)
   04916 Melanogenesis
    101378737 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101378737 (CTNNB1)
   05205 Proteoglycans in cancer
    101378737 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101378737 (CTNNB1)
   05225 Hepatocellular carcinoma
    101378737 (CTNNB1)
   05226 Gastric cancer
    101378737 (CTNNB1)
   05216 Thyroid cancer
    101378737 (CTNNB1)
   05217 Basal cell carcinoma
    101378737 (CTNNB1)
   05215 Prostate cancer
    101378737 (CTNNB1)
   05213 Endometrial cancer
    101378737 (CTNNB1)
   05224 Breast cancer
    101378737 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101378737 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    101378737 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101378737 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101378737 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101378737 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101378737 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    101378737 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101378737 (CTNNB1)
   05163 Human cytomegalovirus infection
    101378737 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101378737 (CTNNB1)
   05165 Human papillomavirus infection
    101378737 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 101378737
NCBI-ProteinID: XP_004417693
UniProt: A0A2U3X5M1
LinkDB
Position
Unknown
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagcg
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaaccctgaggaagaggatgtggataccacc
caagtcctgtacgagtgggaacagggcttttctcagtccttcactcaagaacaagtagct
gatattgatggtcagtatgcaatgacacgagctcagagggtgcgagctgctatgttccct
gagaccctagatgagggcatgcagatcccatctacacagtttgatgccgctcatcctact
aacgtccagcgtttggctgaaccatcgcagatgctgaaacatgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aatgatgaggaccaggtggtggttaataaggctgcagttatggtccatcaactttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaatacaaatgatgtggaaacggctcgctgtactgctgggaccttgcacaat
ctttctcatcatcgtgagggcttgctggccatctttaagtctgggggcattcctgccctg
gtgaagatgcttggttcaccggtggattctgtattattttatgccattacaactctccac
aaccttttattgcatcaagaaggagctaaaatggcagtgcgtttagccggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaacagactgc
cttcagattttagcttacggcaatcaagaaagcaagctgatcatcctggctagtggtgga
cctcaagctttagtaaatataatgaggacctacacttatgagaaactactgtggaccaca
agcagagtactgaaggtgctgtctgtctgctctagtaataaaccagctattgtagaagca
ggtggaatgcaagctttagggcttcacctgacagatccaagtcaacgtcttgttcagaat
tgtctttggactcttaggaatctatcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggaccctcgttcagcttctgggctcagatgatataaatgtggtcacctgtgca
gctggaattctttctaatctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggcgcttgtgcgtactgtccttcgtgctggtgacagggaggacatt
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaggaagcagagatg
gcccagaatgctgttcgccttcactatggactaccagttgtggttaaactcctgcaccca
ccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctctgcgtgagcagggtgccattccgcgactagttcagttgttg
gttcgtgcccatcaggatacccagcgccgtacgtctatgggcggaacacagcagcagttt
gtggagggggtccgtatggaagaaattgttgaaggttgtactggagcccttcatatccta
gctcgggatgttcacaaccgaattgtaatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagctgctggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaagccatcgaagcagagggagccacagctcctctg
acagagttacttcactctaggaacgaaggtgtagcaacatacgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattacaagaaacggctttcagttgagctgaccagt
tctctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggagcatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system