KEGG   Odobenus rosmarus divergens (Pacific walrus): 101378811
Entry
101378811         CDS       T05148                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04072  Phospholipase D signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04640  Hematopoietic cell lineage
oro04916  Melanogenesis
oro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101378811 (KITLG)
   04014 Ras signaling pathway
    101378811 (KITLG)
   04015 Rap1 signaling pathway
    101378811 (KITLG)
   04072 Phospholipase D signaling pathway
    101378811 (KITLG)
   04151 PI3K-Akt signaling pathway
    101378811 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101378811 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    101378811 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101378811 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101378811 (KITLG)
Cytokines and growth factors [BR:oro04052]
 Growth factors
  Growth factors (RTK binding)
   101378811 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 101378811
NCBI-ProteinID: XP_004414903
UniProt: A0A2U3WZ03
LinkDB
Position
Unknown
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTKGICRNRVTDDVKDVTKLVANLPKDYKIALKYVPG
MDVLPSHCWMSVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKTPKSPEHRHFTPEEFFRIFNRSIDALKDLETVASKTSECVVSSTLSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNPVGDSNLQWAAMALPAFFSLVIGFAFGALYWKK
RQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactactcctatttaat
cctctggtcaaaactaaagggatctgcaggaaccgtgtaactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataaaatagccctcaaatatgtccccggg
atggatgttttgcctagtcattgttggatgagcgtgatggtggaacagttgtcagtcagc
ttaactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattactctatc
atagacaaacttgtgaaaatagtggatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaaacacctaagagcccagaacacaggcattttacccctgaagaattc
ttcagaatttttaatagatccattgatgccctcaaggacttggagaccgtggcatctaaa
actagtgaatgtgtggtttcttcaacattaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctcaaaccccgttggagactccaacttacaatgggccgccatggca
ttgccagcattcttctctcttgtaatcgggtttgcttttggagccttatactggaagaag
agacaaccaaatctcacaaggacagttgaaaatatacagattaatgaagaggataatgaa
ataagtatgttgcaagaaaaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system