KEGG   Odobenus rosmarus divergens (Pacific walrus): 101378819
Entry
101378819         CDS       T05148                                 

Gene name
CD34
Definition
(RefSeq) hematopoietic progenitor cell antigen CD34 isoform X1
  KO
K06474  CD34 antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04514  Cell adhesion molecules
oro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101378819 (CD34)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101378819 (CD34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oro04090]
    101378819 (CD34)
CD molecules [BR:oro04090]
 Proteins
  101378819 (CD34)
SSDB
Motif
Pfam: CD34_antigen
Other DBs
NCBI-GeneID: 101378819
NCBI-ProteinID: XP_004415582
UniProt: A0A2U3X0N1
LinkDB
Position
Unknown
AA seq 383 aa
MLVGRGARAGRGMPRGWTALCLLSLLPSGFTNMENMTAVTTESTTQAITSTVFANVSNQV
ATTLSPLGSTTLYPVSQDNNGTTATISETTVNITSTSEIAPVPGTMNSSVQSQTSLAITV
TSIPTSFSTSDMTLKPSLLPGNVSDPPYNSTSLVTSPTEHSTSFSLTPSTIRGEIKCSQV
KEVKLTQGICLELNETSSCEDFKKNNEEELTQVLCEKEQAEAGAGVCSLLLAQSEVKPHC
LLLVLANRTELSSKLQLLKKHQSDLKKLGIQGFTEQDLGSHQSYSRKTLIALVTSGILLA
VLGTTGYFLMNRHSWSPTGERLGEDPYYTENGGGQGYSSGSGASPEAQGKASVNRGAQEN
GTGQATSRNGHSARQHVVADTEL
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgctggtcggcaggggcgcgcgcgcggggcgcgggatgccgcggggctggaccgcgctc
tgcctgctcagtctgctgccctctgggttcacaaatatggaaaacatgactgctgtcacc
acagagtcaaccacccaagcaataacttcaactgtgtttgcaaatgtatccaaccaggtg
gccaccaccctaagtcctcttggaagtaccaccctgtaccctgtctctcaggacaacaat
ggtaccactgcaaccatctcagagactacagttaatatcacatctacctctgagatcgcc
ccagtgcccgggaccatgaactcttctgtccagtcacagacctctttagctatcacagta
acttctatcccaacgagcttttcaacttcagacatgaccttgaagcccagcctgctacct
ggaaatgtttcggatcccccatacaacagcaccagccttgtgacatcccccactgaacac
tctacatcattttctcttaccccaagtaccatcaggggagaaatcaaatgttcccaagtc
aaagaagtgaaattgacccaaggtatctgcctagagctaaatgagacctccagctgtgag
gactttaagaagaataatgaagaggaactgacccaagtcctgtgtgagaaggagcaggct
gaggctggggctggggtgtgctccttgcttctggcccagtctgaggtgaagcctcactgc
ctgctgctggtcttggccaacagaacagaactttccagtaagctccagcttctgaaaaag
caccagtctgacctgaaaaagctggggatccaaggcttcactgaacaagatcttgggagc
caccagagctattcccgcaagaccctgattgcactggtcacctcagggatcctgttggct
gtcttgggcaccactgggtatttcctgatgaaccgccacagctggagccccacaggagaa
aggctgggcgaagacccttattacacggagaacggtggaggccagggctatagctcaggc
tctggggcctcccctgaggctcagggaaaggccagtgtgaaccgaggggctcaggagaac
gggaccggccaggccacatccagaaacggccattcagcaagacaacacgtggtggctgat
acagaattgtga

DBGET integrated database retrieval system