KEGG   Odobenus rosmarus divergens (Pacific walrus): 101378978
Entry
101378978         CDS       T05148                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04218  Cellular senescence
oro04310  Wnt signaling pathway
oro04360  Axon guidance
oro04625  C-type lectin receptor signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04921  Oxytocin signaling pathway
oro05135  Yersinia infection
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101378978 (NFATC3)
   04310 Wnt signaling pathway
    101378978 (NFATC3)
   04022 cGMP-PKG signaling pathway
    101378978 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101378978 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101378978 (NFATC3)
   04660 T cell receptor signaling pathway
    101378978 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    101378978 (NFATC3)
   04659 Th17 cell differentiation
    101378978 (NFATC3)
   04662 B cell receptor signaling pathway
    101378978 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101378978 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    101378978 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101378978 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101378978 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101378978 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    101378978 (NFATC3)
   05161 Hepatitis B
    101378978 (NFATC3)
   05163 Human cytomegalovirus infection
    101378978 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101378978 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101378978 (NFATC3)
Transcription factors [BR:oro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    101378978 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 101378978
NCBI-ProteinID: XP_004393406
UniProt: A0A2U3VFC8
LinkDB
Position
Unknown
AA seq 1072 aa
MTTANCGAHDELDFKLVFGEDGAPAPPPSGSRPADLEPDDCASIYIFNVDPPPSTLNSPL
CLPHHGLPSHSSVLSPSFQLQGHKSYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNC
HQEIDAHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLTPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASLQGGSGLGPALFPFQYCVETDIPLKTRKTSEDQATVLPGKLELCSD
DQGNLSPSRETSIDDGLGSQYPLKKDSSGDQFLSVPSHFTWSKPKPGHTPVFRTSSLPPL
DWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQTASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHKEEVDLSSVPALSV
PHPAQTQRPSSDTGHPHDSVLSTQRSLVCPIQQTYASMVTSSHLPQLQCRDESAGKEQHM
IPSSVMHQPFQVTSTPPVGSSYQPMQTNVVYNGPTCLPVNAASSQDFDPVLFPQDAALPS
LINLGCQPPSSITFHSSNSRHLLAHTPHSVQTLPHLQSMGFHCSNTGQRSLSSPGADQVT
GQPSPQLQPITYGPSHSGSATAASPAVSHPLASSPLSGPPSPQLQPMPYQSPSSGTASSP
SLATRMHSGQHSTQAQNTGQGGLSAPSSLICHNLCDPASFPPDEATVNIKPEPEEQEPNF
STIGLQDITLDDVNEIIGRDMSQISVSQGTVGSRQAPLPGPDSLDIGRSDGL
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgccggcgccgccgccctcgggctcgcggcctgcagatcttgaaccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaactcaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctc
caaggtcacaaaagctatgaaggaacttgtgagattcctgaatctaaatacagcccatta
ggtggtcccaaaccttttgagtgcccaagtattcaaattacatccatctctcctaactgt
catcaagaaatagatgctcatgaagatgacctacacataaatgacccagaaagggagtat
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggagtct
tcccttagtcctagtcctgccagcagtatatcttctagaagctggttctcagatgcatct
tcttgtgaatctctttcacacatttatgatgatgtggattcggagttgaatgaagctgcc
gcccgatttactctcggatcccctctgacttctcctggtggctcgccaggaggctgccct
ggggaagagtcctggcatcaacaatatggacttggacactccttgtcacccaggcaatct
ccttgccactctcctagatctagtgtcactgatgagaattggctgacccccaggccagcc
tcagggccctcatcaaggcctacttccccctgtgggaaacgtcggcactccagtgctgag
gtttgttatgctgggtccctttcaccccatcactcacctgttccttctcctggtcactcc
cccaggggaagtgtaacagaagatacctggcttaatgcttctctccaggggggatcaggc
cttggccctgcactttttccatttcagtactgtgtagagactgatatccctctgaaaaca
aggaagacttctgaagatcaagctactgtactaccaggaaaattagagctctgttcagat
gaccaagggaatttatcaccatcccgggagacttcgatagatgatggccttggatctcag
tatcctttaaagaaagattcatctggtgaccagtttctttcagttccttcacattttacc
tggagcaaaccaaagcctggccacaccccagtatttcgcacatcttcattacctccacta
gactggcctttaccaactcattttggacagtgtgaactgaaaatagaagtgcaacctaaa
actcatcatcgagcccattatgaaactgaaggtagtcgaggagcagtaaaagcatctact
gggggacatcctgttgtaaagctcctgggctatagtgaaaagccgataaatctacagatg
tttattggaacagcagatgatcgatatttacgacctcatgcattttaccaggtgcatcga
atcactgggaagactgttgctactgcaagtcaagagataataattgccagcacaaaggtt
ctggaaattccccttcttcctgaaaacaatatgtcagccagtattgactgtgcaggtatt
ttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaag
aatactagagtacgactcgtgttccgtgtgcacatcccacagcccaatggaaaagtcctt
tctctgcagacagcttccatacctgttgagtgctctcagcggtctgctcaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatgattgtg
actggatctaattttcttccagaatccaaaatcatttttcttgaaaaaggacaagatgga
cgacctcagtgggaggtagaagggaaaataatcagggaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacaccagtt
ttgatgaagcaagaacataaagaagaggttgacttgtcttcagttccagcattgtctgtg
cctcatcctgcccagacccagaggccttcctcagacacaggacacccacatgacagtgta
ctgtcaacacagagaagcttggtttgtcccatccagcaaacatatgcatccatggtaact
tcatctcatctgccacagttgcagtgtagggatgaaagtgctggtaaagaacagcatatg
ataccttcttcagtcatgcaccagccttttcaagtcacatcaacacctcctgtggggtct
tcctatcagcctatgcaaactaatgttgtgtacaacggaccaacttgtcttccagttaat
gctgcctccagtcaagattttgatccggttttgtttccacaggatgcagctcttcctagt
ttaataaatcttggctgtcaaccaccgtcatccataacttttcattcttcaaattcaaga
catctcttagcccacacacctcattcagtgcagaccctgcctcacctgcagtcaatggga
ttccattgttcaaacacaggacaaagatctctttcttctccaggggctgaccaggtcaca
ggccagccttcccctcagttacagcccattacatatggtccttcacattcagggtctgct
acagccgcttccccagcagtctctcatcccctggctagttcaccactttctggcccacca
tctcctcagctacagcctatgccttaccaatctcctagctcaggaactgcctcatcaccg
tctctagccaccagaatgcattctggacagcactcaactcaagcacaaaatacaggccag
ggaggtctttctgcaccttcatccttaatatgtcacaatttgtgtgatccagcttcattt
ccaccggatgaggcaactgtgaacatcaagcctgaacctgaagagcaggaacctaacttt
tcaacgattggtctgcaggacatcactttagatgatgtgaacgagataattgggagagac
atgtcccagatttctgtttcccaaggaacagtggggagcaggcaggctcccctcccgggt
cccgattccctggatataggaagatccgatgggctctga

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101379396
Entry
101379396         CDS       T05148                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04218  Cellular senescence
oro04310  Wnt signaling pathway
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04380  Osteoclast differentiation
oro04625  C-type lectin receptor signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04921  Oxytocin signaling pathway
oro05135  Yersinia infection
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101379396 (NFATC2)
   04370 VEGF signaling pathway
    101379396 (NFATC2)
   04022 cGMP-PKG signaling pathway
    101379396 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101379396 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101379396 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    101379396 (NFATC2)
   04660 T cell receptor signaling pathway
    101379396 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    101379396 (NFATC2)
   04659 Th17 cell differentiation
    101379396 (NFATC2)
   04662 B cell receptor signaling pathway
    101379396 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101379396 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    101379396 (NFATC2)
   04380 Osteoclast differentiation
    101379396 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101379396 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101379396 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101379396 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    101379396 (NFATC2)
   05161 Hepatitis B
    101379396 (NFATC2)
   05163 Human cytomegalovirus infection
    101379396 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101379396 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101379396 (NFATC2)
Transcription factors [BR:oro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    101379396 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 101379396
NCBI-ProteinID: XP_004415035
UniProt: A0A2U3WZA7
LinkDB
Position
Unknown
AA seq 920 aa
MDAPEQQPEPDGGDAPGHEPGGSPQDEFDFSILFDYEYLNPIEEEPNAHKVASPPSGLAY
PDEVLDYGLKPYSPLPSLPGEPPGRFGEPDRVGPQNFLSPAAKPAGASGLSPRIEITPSH
ELMQAGGPLRGRDTGLLGEQPALAGAAASPRFTLPVPGFEGYREPLCLSPASSGSSASFI
SDTFSPCASPCVSPNNGGPDDLCPHFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVP
RPASRSSSPGAKRRHSCAGALVAPLPGASPQRSRSPSPQPQDDGAPAGYPPTAGSAVLMD
ALNSLAADSPCGIPPKMWKTSPDPSPVSAAPPKAGLPRHIYPAVEFLGPCEQEEGRSSAP
ESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRAHYE
TEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVT
TTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLV
FRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFTA
ESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRASVKVNFYVINGKR
KRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPAHGGLGSQPYYPPHPMVAESPSCLVATM
APCQQFRSGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLALADAHRSVL
VHAGSQGQSSTLLHSSPANQQASPVIHYSPTNQPLRCGSHQEFQHIMYCENFAPGPARPG
PPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYL
DDVNEIIRKEFSGPPARNQT
NT seq 2763 nt   +upstreamnt  +downstreamnt
atggacgccccggagcagcagcccgagcccgacggcggggacgccccgggccatgagccc
gggggcagcccccaagacgagttcgacttctccatcctcttcgactatgagtatttgaat
cctatcgaagaagaaccgaatgcacataaggtcgccagcccaccctccggactcgcatac
cccgatgaagtcctggactatggcctcaagccatacagccccctccccagtctccccggc
gagccccccggccgattcggagagcccgatagggtagggccgcagaactttctgagcccg
gcggccaagccagcgggggcctcgggcctgagccctcggatcgagatcactccatctcac
gaactgatgcaggcagggggccccctccgtgggagagacactggcctgctcggggagcag
ccggccctggccggcgcggccgccagcccgcggttcacgctgcccgttcccggcttcgag
ggctaccgcgagccgctttgcttgagcccggctagtagcgggtcctctgccagcttcatt
tccgacaccttctccccctgcgcctcgccctgcgtctcgcccaataacggcgggcccgac
gacctgtgtccccactttcaaaacatccctgctcattattcccccagaacctcgccaata
atgtcacctcgaaccagcctcgctgaggacagctgcctgggccgccactcgcccgtgccc
cgtccggcctcccgctcctcgtcgcctggtgccaagcggaggcattcgtgtgccggggcc
ttggttgccccgctgcccggagcctcaccccagcgctcccggagcccctcgccgcagccc
caggacgacggtgcccccgctgggtacccccccacggcgggctctgccgtcctcatggat
gccctgaacagcctcgccgcggactcgccctgtggcatcccccccaagatgtggaagacg
agccccgacccatcaccggtgtccgccgccccgcccaaggccggcctgccccgccacatc
taccctgccgtggagttcctgggcccctgcgagcaggaggaggggagaagctccgccccc
gagtccatcttgctggtgccgcccacctggcccaagcagctggtgcctgctattcccatc
tgcagcatcccagtgaccgcatccctccctccgcttgagtggccactgtcccaccagtcg
ggctcctatgagctgcggattgaggtgcagcccaagccacatcaccgggcccactatgag
accgaaggcagccgaggggctgtcaaagctccaactggtggccaccctgtcgttcagctc
cacggctacatggaaaacaagcccctggggcttcagatcttcattgggacagctgatgag
cggatccttaagccccatgccttctaccaggtgcaccggatcacgggcaaaaccgtcacc
accaccagctacgagaagatcgtgggcaacaccaaagtcctggagatccctctagagcca
aaaaataacatgagggcgaccattgattgtgccgggatcctgaagcttcggaacgccgac
attgagctgcggaaaggcgagacggacattggcaggaagaacacacgggtgcggctggtg
ttccgagtgcacattccagagtccagtgggaggatcgtctccctgcagactgcgtctaac
cccatcgagtgctcccagcggtctgcccacgagctacccatggtggagagacaagacatc
gacagctgcctggtttacgggggccagcagatgatcctcaccggacagaacttcacggcc
gagtccaaagtcgtgtttactgagaagaccacagatgggcagcaaatttgggagatggaa
gctacggtggataaagacaagagccagcctaacatgctttttgttgagatccctgagtat
cgaaacaagcacatccgtgcatcggtgaaggtgaacttctacgtcatcaatgggaaaaga
aaacgaagtcagcctcagcactttacctaccacccagtcccagccatcaagacggagccc
actgatgaatatgaccccaccttgatctgcagccccgcccacgggggcctggggagccag
ccttactacccaccgcacccgatggtggctgaatcgccctcctgcctcgtggccaccatg
gcaccctgccagcagttccgctcggggctctcgtcccccgatgcccgctaccagcagcag
aacccggcggctgtcctctatcagcggagcaagagcctgagccccagcctgctgggctac
cagcagccggccctcatggccgcccccctggccctggcggacgcccaccgctccgtgctg
gtgcacgccggctcccagggccagagctccaccctgctccactcctccccggccaaccag
caggcctcgccggtgatccactactcgcccaccaaccagccgctgcgctgcggcagccac
caagaattccagcacatcatgtactgcgagaacttcgcgcccggccccgccaggcccggc
ccgccccccgtcagtcaaggccagaggctgagcccggggtcctaccccacggtcattcag
cagcagaatgccaccagccaaagagccgccaaaaacggacccccggtcagtgaccaaaag
gaagtattacccgcaggagtgacaattaaacaggagcagaacttggaccagacctacttg
gatgatgttaatgaaattatcaggaaggagttttcaggacctcccgccagaaatcagacg
tag

KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385449
Entry
101385449         CDS       T05148                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04218  Cellular senescence
oro04310  Wnt signaling pathway
oro04380  Osteoclast differentiation
oro04625  C-type lectin receptor signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04921  Oxytocin signaling pathway
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro05135  Yersinia infection
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101385449 (NFATC1)
   04310 Wnt signaling pathway
    101385449 (NFATC1)
   04024 cAMP signaling pathway
    101385449 (NFATC1)
   04022 cGMP-PKG signaling pathway
    101385449 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101385449 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101385449 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    101385449 (NFATC1)
   04660 T cell receptor signaling pathway
    101385449 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    101385449 (NFATC1)
   04659 Th17 cell differentiation
    101385449 (NFATC1)
   04662 B cell receptor signaling pathway
    101385449 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101385449 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101385449 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101385449 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101385449 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101385449 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101385449 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101385449 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    101385449 (NFATC1)
   05161 Hepatitis B
    101385449 (NFATC1)
   05163 Human cytomegalovirus infection
    101385449 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101385449 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101385449 (NFATC1)
Transcription factors [BR:oro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    101385449 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 101385449
NCBI-ProteinID: XP_004413169
UniProt: A0A2U3WUP3
LinkDB
Position
Unknown
AA seq 823 aa
MPSTSFPVPSKFPLGPSAAVCGSGETLGPAPPSGGTMKSAEEEHYSYASSSISSALPPGS
ARPSLPAPCHDLQTSAPGMPAAAASQPPGYGGAVDSRPSSCFLSSGHVRPNGAPALESPR
IEITSYLGLHHGGNQFFHDAEVEDIPPGSQRPPCTATLGLPGLEAYRDPSCLSPASSLSS
RSCNSEASSFESGFSYPYASPQTSPWQSPCVSPKTTDPEDGFPRGLGACGLLGSPRHSPC
ASPRASVTEESWLGARTSRPPSPCNKRKHGLNGRQPSGSPHHSPTPSPRSSPRVSVTDDT
WLGNSTQYTSSAIVAAINALSTDSSLELDGVPMKARKTALDHCPSVALKVEPAGEDLGTT
PPTSEFLPEEFLSFQHIRKGAFCDQYLSVPQHPYQWARPRSPASYTSPSLPALDWQLPSR
SGPYELRIEVQPKPHHRAHYETEGSRGAVKASAGGHPSVQLHGYLENEPLTLQLFIGTAD
DRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENNMRAIVDCAGILKLRNS
DIELRKGETDIGRKNTRVRLVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQS
AASCPVLGGKKMVLSGHNFLQDSKVIFVEKAPDGHHIWEMEAKMDRDLCKPNSLVVEIPP
FRNQRITSPVQVSFYVCNGKRKRSQYQHFTYLPANAPTIKTEPTDDYEPALTCGPMSQGP
SPLPKPCYSQQLVMPPDPGSCLVAGFPPCPQRSTMVSPPPSSSPKLHDLSSATYSKGMAS
PGHGHLGLQRPAGGVLTVPETPRPVGVHPGPPQQPPPALLRPQ
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgccaagtaccagttttccagtcccttccaagtttccactcggcccttcggctgcagtc
tgcgggagcggagaaactttggggcccgcgccgccctccggcggcaccatgaagtcggcg
gaggaagagcactatagttatgcgtcctcgagcatcagctctgctctgcctcccggctcg
gctcgcccctcgctgccagctccatgccatgacctgcagacctcggccccaggcatgccg
gccgctgcggcaagtcagcccccgggctatggtggggcggtggacagcaggccctcgagc
tgcttcctctcctctggccatgtcaggcccaatggggcccccgccctggagagtcctcgc
atcgagatcacctcgtacctgggactgcaccacggcggcaaccagtttttccacgatgcg
gaggtagaagacatccctcccggctcccagcggcccccgtgcacggccacgctgggtctg
cccggcctggaggcctaccgcgacccctcctgcctgagcccggccagcagcctgtcatcc
cgtagctgcaactctgaggcctcgtcgttcgagtctggcttctcgtacccctacgcgtcc
ccacagacgtccccgtggcagtcaccctgtgtgtcccccaagaccacggaccccgaggac
ggcttcccccggggcctgggggcctgcggcctgctcggctcccccagacactcaccctgc
gcctcgccccgcgcaagcgtcacggaggagagctggctgggggcccgcacgtcccggccc
ccgtccccctgcaacaagaggaaacatggcctcaatggccggcagccgtccggctcccca
caccactcgcccacaccgtccccacgcagctcgccgcgggttagcgtcaccgacgacacc
tggctgggcaacagcacgcagtacacgagctccgcgatcgtggccgccatcaacgccctc
agcaccgacagcagcctggagctggacggcgtccccatgaaggcgcgcaagaccgccctg
gaccactgtccctctgtggcgctcaaggtggagccagcgggcgaggacctggggaccacg
ccgcccacgtccgagttcctgcccgaagagttcctgtccttccagcacatccggaagggt
gcgttctgtgaccagtacctgtcggtgccgcagcatccataccagtgggcccggccccgg
tccccggcctcctacaccagcccgtccctccccgccctggactggcagctgccatcgcgc
tcgggaccctacgagctgaggatcgaggtgcagcccaagccccaccacagagcccactat
gagacggaggggagccggggggccgtgaaggcatcggccggaggacaccccagcgtgcag
ctacacggctacttggagaatgagccactcacactacagctgttcattgggacggccgac
gaccgcctgctgagaccccacgccttctaccaggtccaccggatcacaggcaagaccgtc
tccaccaccagtcacgaagccatcctctccaacaccaaagtcttggaaatcccactgctg
ccagagaacaacatgcgagccattgtggactgtgccgggattctgaagcttcgaaactcg
gacatcgagctgcggaaaggagagacggatatcgggaggaagaacaccagggtgaggctt
gtcttccgggtgcacatcccacagcccaacggccggacgttgtccctgcaagtggcctcc
aaccccatcgagtgctcccagcggtcggcccaggaactgcccctcgtggagaagcagagc
gcagccagctgccctgtcctcggtgggaagaagatggtcctgtctggccacaactttctg
caggactccaaggtcatttttgtggagaaagcaccagacggtcaccacatctgggagatg
gaggcgaagatggacagagacctgtgcaagccgaactcgctggtggttgagatcccgcct
ttccgcaatcagagaataaccagccctgtgcaagtcagcttctatgtctgcaacgggaag
agaaagagaagtcagtaccagcacttcacctaccttcctgcgaacgctcctaccataaaa
acagagcccaccgatgattacgagcctgctctgacctgtggaccaatgagccagggcccg
agccctctccccaagccgtgctacagccagcagctggtgatgccgcctgacccgggctcc
tgcctggtggctggcttcccgccctgtccacagaggagcaccatggtgtcaccgcccccc
agcagcagcccgaagctccacgacctctcttccgccacctacagcaagggcatggccagc
ccgggccacggtcaccttggacttcagcggccggccggaggggtcctcaccgttccagag
acaccgagacctgtgggtgtgcaccccggccccccccagcagccgcctcctgccctgctg
cgaccacagtaa

DBGET integrated database retrieval system