KEGG   Odobenus rosmarus divergens (Pacific walrus): 101379114
Entry
101379114         CDS       T05148                                 

Gene name
CR2
Definition
(RefSeq) complement receptor type 2
  KO
K04012  complement receptor type 2
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04610  Complement and coagulation cascades
oro04640  Hematopoietic cell lineage
oro04662  B cell receptor signaling pathway
oro05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101379114 (CR2)
   04610 Complement and coagulation cascades
    101379114 (CR2)
   04662 B cell receptor signaling pathway
    101379114 (CR2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101379114 (CR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oro04090]
    101379114 (CR2)
CD molecules [BR:oro04090]
 Proteins
  101379114 (CR2)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 101379114
NCBI-ProteinID: XP_004415583
UniProt: A0A2U3X0N7
LinkDB
Position
Unknown
AA seq 1094 aa
MGAAGLLCVFLAVIAPGVLGISCDPPPPIKNGWNSYSSGPIPLNTVVRYTCSSAFRLIGE
RILFCISKDQVKGIWDKAAPVCEYYNRNSLCPEPIVAGGYRDKRSRPPYRHGDSVTFTCD
TNFTMKGNKSVWCQANKTWGPTPLPICESDFPQECPPLPTIPNGSHTGERVGPFAPGLSV
TYSCEPGYLLVGEKTIRCLSSGKWSAVIPTCKEAQCEPPGPFLNGQIKGPPSLRVGATVN
FDCNEGYRLQGQPSSQCVIAGQRASWTRMPVCKEIVCLPPPSILNGRHTGSSSGNFPYGS
TVTYTCDPDPEKGVRYILTGEKTIRCITNSQKTGIWSHPAPICELSSSAIQCPPPQILRG
QISSGQKEQYSYNDTVVFACSYGFTLKGSKAIRCNAQGTWEPPAPVCEKGCQAPPTVLNG
QKEDGHMVRFDPGTSIKYSCDPGYVLVGKESIRCTSEGVWTPTAPKCKVAECEPIEKQVF
KKPQDQFVRPDVNSSCDEGYRLGGSVYQKCQGAIPWFMEIRLCEEIICPPPPAIYNGKHT
GSSSGDILYGTTVTYTCNPAPESGVEFNLTGESTIRCISNDQERGIWSGPAPVCKLFLPA
VQCPPAQVANGYKISGKDAPYFYNDSVTFKCNHGFILKGSHQIRCKADSTWDPEIPVCEK
GCQPPFGLQHGQHTGGNRVLFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSPPRCEA
PCQPVRDFQEPPIHSHVIPVNTSCQDGYRLTGHTYQKCQDAENRVWFQKIPLCKVIHCQP
PPMIDHGRPRGVMAEPFLYGNEVSYECDQGFSLLGEKNIRCISDSEGRGSWTGPSPKCLK
SPPVIHCPSPEVKHGYKLNKTRSSYSHNDTVHVTCNPGFIMNGSHVIRCHTNNKWVPGVP
TCIKKASLGCQPPLKIPNGNHTGGDIVRFSPGMSILYSCDQGYLLVGEALLLCTHEGIWS
QSAPYCKEVNCSSPEYMNGIQKGLEPGKMYQYGAIVTLECEEGYTLEGSPQSQCQDDQGW
NPPLAVCKSPASLAPLLSGLSAGSFLLVFLIGVTLCTILKYRERNYSTNQIPQEGDLHLE
TREVYSIDPYNPAS
NT seq 3285 nt   +upstreamnt  +downstreamnt
atgggcgctgcgggcctgctctgcgttttcttggctgtcatcgcgccaggggttctaggg
atttcttgtgaccctcctcctcctatcaaaaatggttggaatagttattcttctggtccc
atacctcttaacactgtggtaaggtacacttgttctagtgccttccgcctcattggagaa
agaatccttttttgtataagtaaagaccaagtgaaaggaatctgggataaagctgctcct
gtatgtgaatattataatagaaattctctttgccctgagcccatagtagcaggaggatac
agagataaaagatctagaccaccatacagacacggtgattctgtgacattcacctgtgat
accaactttaccatgaaaggaaacaaatctgtttggtgccaagcaaataaaacctggggg
ccaacaccactaccaatctgtgagagtgatttcccccaggagtgtccaccacttccaacc
atccccaatggatctcacacaggggagagggttggcccctttgccccaggattatctgtg
acttacagctgtgaacctggttacttgcttgttggagaaaagaccattagatgtttgtct
tcgggaaagtggagtgctgttattcccacatgtaaagaagcacagtgtgaacctccagga
ccatttctcaatggacagataaagggccctccaagtcttcgggttggtgcgactgtgaac
tttgactgtaacgaagggtatcggttacaaggccaaccttccagtcaatgtgtaattgct
ggacagcgggcttcttggaccaggatgccagtatgcaaagaaattgtttgcctgccacct
ccttctattctcaatggaagacatacaggcagctcttcggggaactttccatacggaagc
acagttacttacacctgtgacccagacccagagaaaggagtgagatatatccttaccggg
gagaagactatccgttgtatcaccaatagtcagaagactggaatctggagtcaccctgcc
ccaatctgtgaactttctagttctgccattcagtgtccacctccccagatcctaagaggc
caaatatcatctgggcagaaagagcaatattcctataatgacaccgtggtatttgcttgc
tcatatggcttcaccctgaagggcagcaaggcaatccgatgtaatgcccaaggcacgtgg
gagccaccagcaccagtctgtgaaaaggggtgccaagcccctcctacagtcctcaatggg
caaaaggaagatggacacatggtccgctttgacccaggaacatctataaagtacagctgt
gaccctggctatgtgctcgtggggaaagaatccatacgttgtacctctgagggggtgtgg
acacccactgcccccaaatgcaaagtggcggagtgtgaacctatagaaaagcaagtcttt
aagaaaccccaggatcaatttgttagaccagatgttaactcttcttgcgacgaagggtac
cggttaggggggagtgtttatcagaagtgccaaggagcgattccttggtttatggagatt
cgtctttgtgaagaaatcatctgcccaccacctcctgccatctacaatgggaaacatacg
gggagttcctcaggagatattctatatggaaccacagtcacctacacatgcaaccctgcg
ccagaaagcggagtggaattcaacctcactggggaaagcaccatccgttgtataagcaat
gaccaagagaggggcatctggagtgggcctgcccctgtctgtaaactttttctccctgct
gttcagtgtccacctgcccaggttgcaaatggatacaagatatctggcaaggatgcccca
tatttctacaatgacagtgtgacattcaagtgtaatcatggatttattctgaagggcagc
catcagattcgttgcaaagccgatagcacctgggatcctgaaataccagtttgtgaaaaa
ggctgccagccaccttttgggctccagcatggtcagcatacaggtggaaatagggtcctc
tttgtctctgggatgactgtagactacacctgtgaccctggctacttgcttgtgggaaac
aaatccattcactgtatgccttcaggaaattggagtccttctccccctcggtgtgaagca
ccatgtcagcctgtgagagattttcaagagcctcccattcattcacatgtgataccagtc
aatacatcctgtcaagatgggtaccggttgacaggacatacttatcagaagtgtcaagat
gctgagaatagggtttggttccaaaagattccactttgtaaagtaattcactgtcagcct
ccacccatgattgaccatggaaggcccaggggcgtgatggcagaaccctttctatatgga
aatgaagtctcttatgaatgtgaccaaggattctctcttctgggagagaaaaatatacga
tgcataagtgattctgaaggacgtggatcttggactggaccttccccaaagtgcttaaaa
tctccgcctgtgattcactgccctagcccagaagtcaaacatgggtacaagctcaacaaa
actcgttcctcatattcccacaatgacacagtgcatgtcacctgcaatcctggcttcatc
atgaatggcagtcacgtgattaggtgtcataccaataacaaatgggtgccaggtgtaccg
acttgtatcaaaaaggcttccttaggatgtcaacctccacttaagatacccaacgggaat
cataccggtggagatatagttcgattttctcccggaatgtcaatcctgtacagctgtgac
caaggctacctgcttgtgggagaagcactccttctttgcacacatgagggaatctggagc
caatctgccccttattgtaaagaggtaaactgtagctccccagagtatatgaatggaatc
cagaaggggctggagcctgggaaaatgtatcagtatggtgcgatcgtcactttggagtgt
gaagagggttataccctggaaggcagtccccagagccagtgtcaggatgatcagggatgg
aacccgcccctggctgtctgcaaatcaccggcttcacttgctcctcttcttagtggtctt
tctgcaggttcatttcttcttgtattcttgattggtgtcaccttatgcacaatattaaaa
tacagagaacgcaattattctacaaatcaaatccctcaagaaggagatcttcatttagaa
acacgggaagtatattctattgatccatacaacccagcaagctaa

DBGET integrated database retrieval system