KEGG   Odobenus rosmarus divergens (Pacific walrus): 101379900
Entry
101379900         CDS       T05148                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04061  Viral protein interaction with cytokine and cytokine receptor
oro04068  FoxO signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04630  JAK-STAT signaling pathway
oro04660  T cell receptor signaling pathway
oro04672  Intestinal immune network for IgA production
oro05133  Pertussis
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05143  African trypanosomiasis
oro05144  Malaria
oro05145  Toxoplasmosis
oro05146  Amoebiasis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101379900 (IL10)
   04068 FoxO signaling pathway
    101379900 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101379900 (IL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101379900 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101379900 (IL10)
   04660 T cell receptor signaling pathway
    101379900 (IL10)
   04672 Intestinal immune network for IgA production
    101379900 (IL10)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101379900 (IL10)
   05322 Systemic lupus erythematosus
    101379900 (IL10)
   05320 Autoimmune thyroid disease
    101379900 (IL10)
   05321 Inflammatory bowel disease
    101379900 (IL10)
   05330 Allograft rejection
    101379900 (IL10)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101379900 (IL10)
   05133 Pertussis
    101379900 (IL10)
   05150 Staphylococcus aureus infection
    101379900 (IL10)
   05152 Tuberculosis
    101379900 (IL10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101379900 (IL10)
   05144 Malaria
    101379900 (IL10)
   05145 Toxoplasmosis
    101379900 (IL10)
   05140 Leishmaniasis
    101379900 (IL10)
   05142 Chagas disease
    101379900 (IL10)
   05143 African trypanosomiasis
    101379900 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101379900 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101379900 (IL10)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101379900 (IL10)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Heparin
  Cytokines
   101379900 (IL10)
SSDB
Motif
Pfam: IL10 IL22 ALIX_LYPXL_bnd CLZ
Other DBs
NCBI-GeneID: 101379900
NCBI-ProteinID: XP_004417638
UniProt: A0A2U3X5H9
LinkDB
Position
Unknown
AA seq 178 aa
MPSPSLLCCLVLLVGVGASRHQSALSEDNCTHFPASLPHMLRELRAAFGRVKTFFQMKDK
LDNMLLTGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFSKLQERGVYKAMSEFDIFINYIETYMTMKMKI
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcccagcccatcgctgctgtgttgcctggtcctcctggtcggggtaggagccagccga
catcagagcgccctgtctgaggacaactgcacccacttcccagccagcctgccccacatg
ctccgagagctccgagctgccttcggcagggtgaagactttttttcaaatgaaggacaag
ctggacaacatgttgttgactgggtccttgctggaggactttaagggttacctgggttgc
caagccttgtcggagatgatccagttctacctagaggaggtgatgccccaggctgagaac
cacgacccagacatcaaggagcacgtgaactccctgggggaaaagctgaagaccctcagg
ctgaggctgcggcgttgccatcgctttctgccctgtgagaataagagcaaggcagtggag
caggtgaagaacgcctttagtaagctccaagagagaggtgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaaacctacatgacaatgaagatgaaaatctga

DBGET integrated database retrieval system