KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380066Help
Entry
101380066         CDS       T05148                                 

Gene name
SETD8
Definition
(RefSeq) N-lysine methyltransferase SETD8 isoform X1
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101380066 (SETD8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oro03036]
    101380066 (SETD8)
Enzymes [BR:oro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101380066 (SETD8)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101380066 (SETD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET ArlS_N
Motif
Other DBs
NCBI-GeneID: 101380066
NCBI-ProteinID: XP_004395969
UniProt: A0A2U3VLT8
LinkDB All DBs
Position
Unknown
AA seq 352 aa AA seqDB search
MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTNGENVFTGQSKIYSYMSP
NKCSGMRSPLQEENSVAHHEVKCQGKPLAGLYRKREEKRNSGNAVRSTMKSEEQKLKDAR
RGPLAPFPNQKSEAAEPPKTPTSSCDPAIAAVAKPALKKPVKGKQAPRKKAQGKTQQNRK
LTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGE
FVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHS
KCGNCQTKLHDIDGVPHLILIASRDIKAGEELLYDYGDRSRASIEAHPWLKH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctagaggcaggaagatgtccaagccccgcgcggtggaggcggcggcggcggcggcg
gcggtggcagcgacggccccgggcccggagatggtggagcggaggggcccggggaggccc
cgcaccaacggggagaatgtatttaccgggcaatcaaagatctattcctacatgagcccc
aacaaatgctctggaatgcgttccccccttcaggaagagaactcagttgcacatcacgaa
gtcaaatgccaggggaagccattagccggactctacaggaaacgagaagagaagagaaac
agtgggaacgcggtacggagcaccatgaagtccgaggaacagaagctcaaagacgccagg
agaggtcccctggcaccttttccaaaccaaaaatctgaagcagcagaacctcccaaaact
ccgacctcgtcttgtgatcctgctatcgccgccgtggccaagccagccctgaaaaagcct
gtcaagggcaaacaggcccctcggaaaaaagctcaagggaagacacagcagaaccgcaaa
ctcacggatttctacccggtgcgcaggagctcccggaagagcaaagccgagctgcagtct
gaagaaaggaaaagaatagacgagttgattgaaagtgggaaggaagaaggaatgaagatt
gacctcatcgacggcaagggcaggggtgtgatcgccaccaagcagttctcccggggcgag
tttgtggtcgagtaccacggggacctcatcgagatcaccgacgccaagaagcgggaggct
ctgtatgcacaggacccctcgacgggctgctacatgtactattttcagtatctgagcaaa
acctactgtgtggatgcaactagagagacaaatcgcctgggacgactgatcaatcacagt
aaatgtggaaactgccaaactaaactgcacgacattgacggcgtgcctcacctcatcctc
atcgcctcccgcgacatcaaggccggggaggagctcctgtacgactacggggaccgcagc
cgcgcctccatcgaagcgcacccctggctgaagcattaa

DBGET integrated database retrieval system