KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380075Help
Entry
101380075         CDS       T05148                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00020  Citrate cycle (TCA cycle)
oro00190  Oxidative phosphorylation
oro01100  Metabolic pathways
oro01200  Carbon metabolism
oro04714  Thermogenesis
oro04932  Non-alcoholic fatty liver disease (NAFLD)
oro05010  Alzheimer's disease
oro05012  Parkinson's disease
oro05016  Huntington's disease
Module
oro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oro_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:oro00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101380075 (SDHB)
  Energy metabolism
   00190 Oxidative phosphorylation
    101380075 (SDHB)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    101380075 (SDHB)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101380075 (SDHB)
   05012 Parkinson's disease
    101380075 (SDHB)
   05016 Huntington's disease
    101380075 (SDHB)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101380075 (SDHB)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101380075 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 101380075
NCBI-ProteinID: XP_004397139
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MAAVVGLSLKRRFPLATVGGACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LTKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKGKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcggactctccttgaagcgccggttcccgcttgcaaccgttggcgga
gcttgcctgcaggcctgccggggggcacagacagctgccgcaacagctccccgaatcaag
aaatttgccatctaccgatgggacccagacaagactggagataaacctcacatgcaaact
tatgaaattgatttgaataaatgtggtcctatggtgttggatgctttaatcaagattaag
aatgaaattgattctaccttgaccttccgaagatcatgcagagaaggcatctgtggctct
tgtgccatgaacatcaacggaggcaacactctggcctgcacccgaaggatcgacaccaac
ctcaccaaagtctcaaaaatctaccctcttccgcatatgtatgtgataaaggatcttgtt
cccgacttgagcaacttctacgctcagtacaaatccattgaaccttatttgaagaagaag
gatgaatcccaggagggcaagcagcagtatctgcagtccatagaagatcgtgagaaactg
gacgggctgtacgagtgcatcctctgtgcgtgctgcagcaccagctgccctagctactgg
tggaacggagacaagtacctggggcctgcggttcttatgcaggcctaccgctggatgatc
gactcgagagacgacttcacagaggagcgcctggccaagctgcaggaccccttctccctc
taccgctgccacaccatcatgaactgcaccaggacctgccccaaggggctgaatccaggc
aaagctattgctgaaatcaagaaaatgatggccacctataaggggaagaaagcatcagtg
taa

DBGET integrated database retrieval system