KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380168
Entry
101380168         CDS       T05148                                 

Gene name
RBL2
Definition
(RefSeq) retinoblastoma-like protein 2 isoform X2
  KO
K16332  retinoblastoma-like protein 2
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04068  FoxO signaling pathway
oro04110  Cell cycle
oro04151  PI3K-Akt signaling pathway
oro04218  Cellular senescence
oro05165  Human papillomavirus infection
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101380168 (RBL2)
   04151 PI3K-Akt signaling pathway
    101380168 (RBL2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101380168 (RBL2)
   04218 Cellular senescence
    101380168 (RBL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101380168 (RBL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101380168 (RBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101380168 (RBL2)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    101380168 (RBL2)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB SLH
Other DBs
NCBI-GeneID: 101380168
NCBI-ProteinID: XP_004395883
UniProt: A0A2U3VLL1
LinkDB
Position
Unknown
AA seq 1138 aa
MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAQPARSPAPQTQQRFDELCSRLNMDE
AARAEAWDSYRNMSESYTLEGNDLHWLACALYVACRKSVPTVNKGTVEGNYVSLTRILRC
SEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEE
QPRQQRGRKQRRQPCTVSEVFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNA
LQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCVIEKLCSLHDGLVLEAKGIKEHFWKP
YIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGEDAEE
EIGTLSRCLNSGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYMKDNSPCVTPVS
TAAHSLSRLHAMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMYEIYSQHCQPDEDF
SNSKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVT
FSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKP
ESPLWDRIRDNENRVPTCEEVMPPQNLERAEDICIAGSPLTPRRVSEVRADTGGLGRSLT
SPATLYDRYSSPTASSTRRRLFVENDNPSDGGTPGRIPPQPLVNAVPVQNVSGDAVPVTP
VPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPLS
AQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGHQQKQGPPLTSSSIRPRKTSSLSLFFR
KVYHLAGVRLRDLCSKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMAK
VTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDRT
SRDSSPVMRSSSTLPAPQPSSAPPTPTRLTGANSDMEEEERGDLIQFYNSIYIKQIKTFA
LKYSQANMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNSP
SKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGAH
NT seq 3417 nt   +upstreamnt  +downstreamnt
atgccttcgggaggcgaccagtcgccgccgcccccgcctcctcctccggcggcggcagcc
tcggatgaggaggaggaagacgacggggaggcggaggacgccgcgcagccggcgcgatcg
ccggcccctcagacccagcagcggttcgacgagctgtgcagccgcctaaacatggacgag
gcggcgcgggccgaggcctgggacagctaccgcaacatgagcgagagctacacgctggag
ggaaatgatcttcactggttagcatgtgccttatatgtggcttgcagaaaatctgtgcca
actgtaaacaaagggacagttgaaggaaactatgtatctttaactagaatcctgcgatgt
tcagagcagagcttaattgaattttttaacaagatgaagaagtgggaagacatggcaaat
ctacccccacatttcagagaacgtactgagagattagaaagaaacttcactgtttcagcg
gtaatttttaagaaatatgaacccatttttcaggacatttttaaatatcctcaagaggag
cagcctcgtcaacagagaggaagaaaacagcggcgacagccctgtaccgtgtccgaagtt
ttccatttttgttgggtgctctttatatacgcaaaaggtaatttccccatgattagtgat
gatttggtcaattcttaccatcttctcctgtgtgctttggacttggtttatggaaatgcc
cttcagtgttccaatcgcaaagaactggtaaatcctaattttaaaggcctgtctgaagat
tttcatgctaaggattctaaaccttcctccgatccaccttgtgtcattgagaaactctgt
tccttacatgatggcctagttttggaagcaaagggaataaaagaacatttctggaaaccc
tatattaggaaactttatgaaaaaaagctccttaagggaaaagaagaaaatcttacagga
tttttagagccggggaattttggagagagttttaaagccatcaataaggcctatgaggag
tatgttttatctgttgggaatttagatgaaaggatatttcttggagaggatgctgaagag
gaaattgggactctctccaggtgtctgaattctggttcaggaacagagactgctgaaagg
gtgcagatgaaaaacatcttgcagcagcacttcgacaagtctaaagcacttagaatctcc
acaccacttaccggtgtgaggtacatgaaggataatagcccttgtgtgaccccagtgtct
acggcagcacacagcttgagccgtcttcacgccatgctaacaggcctcaggaatgcacca
agtgagaaactggaacagattctgaggacatgttccagagatccaacacaggccattgcc
aacagattgaaagaaatgtatgaaatatattctcagcattgccagccagatgaggatttc
agtaattctaaagaaattgccagcaaacattttcgttttgcagagatgctttactataaa
gtattagaatctgttattgaacaggaacagaaaagactgggagacatggatttatctggc
attctggaacaagatgcattccatagatcgcttttggcctgctgccttgaggtcgtcact
ttttcttataagcctcctgggaattttccatttattactgaaatatttgatgtgccactt
tatcatttttataaggtgatagaagtattcattagagcagaagatggtctttgtagagag
gtagttaaacaccttaatcagattgaagaacagatcttggatcatttggcatggaaacca
gagtctccactctgggacagaattagagacaatgaaaacagagttcctacttgtgaagag
gttatgccacctcagaatctggaaagagcagaagatatttgtattgctggctctcctttg
actcccagaagggtgagtgaagttcgtgctgatactggaggacttggaagaagcctaaca
tctccagccacactgtatgacagatacagctccccaacagccagctctaccagaaggcgg
ctgtttgttgagaatgataacccctctgacggagggacacctgggcgcattcccccacaa
cccctagtcaatgctgtccctgtacagaatgtatctggagatgctgttcctgtcacacca
gttcctggacagactttggtcaccatggcaacagccactgtcacagccaacaatggacaa
acagtgaccattcctgtacaaggtattgcgaatgaaaatggagggataacattcttccca
gtccaggtcaatgtcggagggcaggcacaagctgtgactggctccatccagcccctgagt
gctcaggccctggctggaagtttgagctctcaacaggtgacaggaacaaccttgcaagtc
cctggtcaggtggccattcaacagatttccccaggtggacaccagcagaaacaaggccca
cctttaaccagcagcagtatcagacccaggaagaccagctctttatcgcttttctttaga
aaggtttaccacttggcaggtgtccgccttcgggatctttgctctaaactggatatttca
gatgaactgaggaaaaaaatctggacctgttttgaattctccataattcagtgtcctgaa
cttatgatggacagacatctggaccagttgttgatgtgtgccatttatgtgatggcaaag
gtcacaaaagaagacaagtccttccagaatattatgcgttgttataggactcagccacag
gcccgaagccaggtgtatagaagtgttttgataaaagggaaaaggaaaagaagaaattct
ggcagcagtgatagcagaagccatcagaattctccaacagaactaaacaaagacagaacc
agcagagactccagtcctgtcatgaggtcaagcagcaccttgccggctccacagcctagc
agcgcccctcctacaccgactcgcctcacaggtgccaacagtgacatggaagaggaggag
aggggagacctcattcagttctacaacagtatctacataaagcaaattaaaacctttgcc
ttgaagtactcacaggcaaacatggacgctcctccactctctccctatccatttgtaagg
acaggttctcctcgccgaatacagctgtctcaaaatcatcctgtctacatttctccacat
aaaaatgaaacaatgctttctcctcgagaaaagattttctactacttcagcaacagtcct
tcaaagagattgagagaaattaacagtatgatacggacaggagaaactccaaccaaaaag
agagggattcttttggaagatggaagtgaatcacccgcaaaaagaatttgcccggaaaat
cattctgccttattacgccgtctccaagatgtagctaatgaccgaggtgctcactga

DBGET integrated database retrieval system