KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380291Help
Entry
101380291         CDS       T05148                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal isoform X1
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00052  Galactose metabolism
oro00500  Starch and sucrose metabolism
oro01100  Metabolic pathways
oro04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101380291 (MGAM)
   00500 Starch and sucrose metabolism
    101380291 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101380291 (MGAM)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101380291 (MGAM)
    3.2.1.20  alpha-glucosidase
     101380291 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101380291
NCBI-ProteinID: XP_004416609
UniProt: A0A2U3X385
LinkDB All DBs
Position
Unknown
AA seq 1846 aa AA seqDB search
MARKKLKDFTSLELMLSVLLLMVFIITIPLFVLSAKDSLESQELSDGHFMFVFGIIPDPG
ATVTPDPGTTSTTPDPATCPVVSEVERINCIPDQPPTKATCDQRGCCWRPQGTISVPWCY
YSKSHGYQMEGDLVKTNAGFTAQLKRLPSPSLFGNDVNNVLLTAEYQTSNRFHFKLTDQS
KDRYKVPHEHVQPFKGDAASPLTYEVMVSEQPFSIKVIRRSNNRVLLDSGIGPLLFADQF
LQLSTRLPSANVYGLGEQVHQQYRHDLNWKTWSMFARDTAPNGDGTNLYGTQTFFLCLED
ASGLSFGVFLMNSNAMEVAFQPTPAVTYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPA
LPSYWALGFHLSRYDYGTLDSMKEVVERNRAAGLPYDVQHADIDYMDKRKDFTYDPVNFK
GFPEFVKELHNNSQKLVIIVDPAISNNSSPSNPYGPYDRGSGMKIWVNASDGVTPLIGEV
WPGKTVFPDYTNPDCAVWWAKEFELFHNQVEFDGIWIDMNEVSNFVDGSISGCSMSNLNY
PPFTPRILDGYLFSKSLCMDAVQHWGRQYDVHNLYGYSMAMATAEAIKTVSPNKRSFIIT
RSTFAGSGKFAAHWLGDNAATWNDLRWSIPGVLEFNLFGIPMVGADICGFALDAPEELCR
RWMQLGAFYPFSRNHNGQGYKAQDPASFGADSLLLNSSRHYLTIRYTLLPYLYTLFYRAH
SRGDTVARPLLHEFYGDSSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYMPDAVWYDYET
GAQVRWRKQRVEMELPGDKIGLHLRGGHIFPTQQPATTTAASRRNPLGLIIALDDNKEAK
GELFWDDGETKDTVANQVYLFCEFSATQNYLDVKILQSTYKDPNNLVFKEIKLLGTQEPT
NVTVKHNGVPSQISPKVTYDSNLQVALITGIDLILGEAYTVEWDLKIRDAEKIDCFPDES
GASAENCTARGCAWEVPTSPGVPFCYFVNDLYSVDNVQYDSQGATATISLKSSVYASALP
SVPVTSLRLRVTHHKNDMLQFKIYDPNNNRYEVPIPLNIPTVPSSTSESQLYDVLIKKNP
FGIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSQYIYGFGETEHTAFRRDLNWHTW
GMFSRDQPPGYKKNSYGVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTIGGI
LDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQI
PYDVQYSDIDYMERQLDFTLSPKFMGFPALINRMKADGMRVILILDPAISGNETQPYPAF
TRGVEDDVFIKTPNGGDIVWGKVWPDFPDVIIDESLDWETQVKLYRAYVAFPDFFRNSTT
TWWKRELQELYTNPQNPERSLKFDGMWIDMNEPASFVNGAVPPGCKDATLNHPPYMPYLE
SRDRGLSSKTLCMESEQVLPDGSRVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRS
TFPSSGRWGGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRW
MQLGAFYPFSRNHNTIGTRRQDPVSWDAAFVDISRSVLLTRYTLLPYLYTLMHMAHTEGS
TVVRPLFHEFVSDRVTWDVDSQFLLGPAFLVSPVLEPNASNVTAYFPRARWYDYYTGVDI
GARGEWRSLAAPLNHINLHVRGGYILPWQEPAQNTHLSRQKFIGFKVALDDEGTANGWLF
WDDGESIDTYGKGLYYLANFSANQNMMQNHIIFNKYITDSNPLKLGYVEIWGVGSVPISS
VSLSVSSMVITPNYTNDPVTQVLSIDVTSRDISLHNFISLTWRSTL
NT seq 5541 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaagatttcacgagtttggagcttatgctcagtgttcttctg
cttatggtgtttatcatcactattcctctgtttgtgctttcagctaaagattctttggaa
tcacaagagctgtctgatggtcattttatgtttgtttttgggattatcccagatcctgga
gcaacagttaccccagatcctgggacaacaagtaccacccctgatcctgctacgtgccca
gtagtaagtgaagtggaacggataaattgcatccctgaccagccaccaacaaaggccaca
tgtgatcagcgtgggtgctgctggagacctcaggggaccataagtgtgccctggtgctac
tattctaaaagtcatggttatcaaatggagggtgaccttgtcaaaacaaatgcaggattc
acagcccagttgaaaaggttgccttctccatccttatttggaaatgatgtcaacaatgtc
ctactcacagcagaataccagacgtccaatcgtttccactttaagctaactgaccagagc
aaggacaggtacaaagtacctcatgaacatgtgcaacccttcaaaggagatgctgcttct
cccttgacctatgaagttatggtctccgaacagccatttagcatcaaagtgatcagaaga
agtaataatcgtgttctgttggactcaggcatcggacccctcctgtttgccgatcagttc
ctgcagctctccacccgactgcccagtgctaacgtgtacggtctgggagaacaggtgcat
caacagtaccggcatgatttgaattggaagacctggtccatgtttgccagggacacagcc
cccaatggggatggaactaacttgtatggtacacagacattcttcctgtgtcttgaagat
gctagtggattgtcctttggagtgtttctgatgaacagcaatgccatggaggttgccttc
cagcccaccccagctgtcacttaccgcaccatcgggggcattctcgacttctatgtgttt
ttgggaaacactccagagcaagttgttcaagagtatctagagctcattggacggccagcc
cttccctcatactgggcacttggatttcatctcagtcgttatgattatggaacactagat
agcatgaaggaagttgtggagagaaaccgtgcagcagggctcccttatgatgttcagcat
gctgatattgattatatggataagaggaaggacttcacttatgatccagtcaattttaaa
ggtttccctgagtttgttaaggagttacacaataacagtcagaaattggtcatcattgtg
gatccagccatctccaacaactcttcacccagcaatccctatggcccgtatgacaggggt
tcgggcatgaagatatgggtgaatgcttcagatggggtgactccactcattggggaggtc
tggcctggaaaaactgtatttcctgattataccaatcccgattgtgctgtttggtgggca
aaggaatttgagcttttccacaaccaagtagaatttgatggaatctggattgatatgaat
gaagtctccaacttcgttgatggttccatttcaggatgttccatgagcaatctgaattat
cccccattcactcctagaatcctggatgggtacctgttctccaagagtctctgcatggac
gcagtccagcactggggcaggcagtatgacgtccacaatctgtacggctactccatggca
atggccacagcagaagccatcaagactgtgtcccctaataagagaagcttcattataacc
cgttctacatttgcgggatctggcaagtttgcagcccactggttaggagacaacgcagcc
acctggaatgatcttcggtggtctatccctggtgtgctggaattcaacctttttggtatc
ccaatggtgggtgctgacatatgtggctttgcactggatgcccccgaggagctctgtagg
cggtggatgcagctgggggcattttatccattctccaggaatcacaatggccaaggctac
aaggcccaggatcctgcctcctttggagctgactctctgctgttgaactcctccaggcac
taccttaccatccgctacaccctattaccctacctctacaccctcttctaccgcgcccac
agccggggggacacagtggccaggccccttctgcatgagttctatggggacagcagtacg
tgggatgtgcaccaacagtttttatggggccccggcctcctcatcactccggttctggat
gagggtgcagagaaagtgatggcgtatatgcccgatgccgtctggtacgattacgagact
ggggcccaagtgagatggcggaagcaaagggtggagatggaacttcctggagacaaaatc
ggacttcaccttcgcggaggccacatcttccccacacaacagccggccaccaccacagcg
gccagccgccggaaccctcttggtcttatcattgccctagatgataacaaagaagcaaaa
ggcgaacttttctgggatgatggggaaactaaagatactgtggccaatcaagtttatctc
ttttgtgagttttctgccacccaaaactacttggatgtgaagattttgcagtcaacttac
aaagaccccaataatttagtatttaaagagattaaacttcttgggacccaggaacctacc
aatgttactgtgaaacacaacggtgtcccaagtcaaatttctcctaaagtcacttatgat
tctaacctacaggttgctcttattacgggaattgatcttatcctgggagaagcatacacg
gtggagtgggacctgaagataagggatgcagaaaaaatagactgtttccctgacgagagc
ggtgcttctgcagaaaactgtacggcccgtggctgtgcctgggaggtgcccacttcccct
ggagtcccattttgttatttcgtcaatgatctgtactctgtcgacaatgttcagtacgac
tcacagggagccactgcgaccatctccttaaagtcttctgtctatgcctctgctctgccc
tccgtacccgtgacctccctccgtctgcgtgtgacccaccataagaatgacatgctgcag
tttaagatttatgatcccaacaataatcggtatgaagtcccaatccctctcaacataccc
acggttccatccagcacctctgagagccagctctacgatgtcctcattaagaagaatcca
tttgggattgaaattcgccggaagagtacaggcactgtgatttgggactctcagctcctt
ggctttaccttcaatgacatgttcatccgcatctccactcgccttccctcccagtacatc
tatggctttggggaaactgagcacacagcctttcggagagacttgaactggcacacatgg
gggatgttttccagagaccagcccccggggtataagaagaattcctacggagtccacccc
tactacatggcactggaggaggatggcagtgcccatggggtgctcctgctaaacagcaat
gccatggatgtgacattccagcccctgcctgccttgacatatcgcaccataggaggaatt
ctggacttttatgtgttcttggggccaactccggagcttgtcactcagcagtatactgag
ctgattggtcggccagtgatggttccttactggtccttggggtttcagctgtgtcgctat
ggataccagaacgactccgagattgccagcttgtacgatgagatggtggctgcccagatc
ccttatgatgtgcagtactcggatatcgactacatggagcggcagctggacttcaccctc
agccccaagttcatgggatttccagctctgattaatcgcatgaaggctgatgggatgcgg
gtcatcctcattctggacccggctatttctggtaacgagacacagccctatcctgcattc
actaggggtgtggaggatgatgtcttcatcaagactccaaatggcggagacattgtctgg
ggaaaggtgtggcctgatttccctgatgtcattatagacgagtctctagactgggagact
caagtgaagctataccgagcttatgtggcctttcccgactttttccgtaactcaactacc
acgtggtggaagagggagttgcaagaactctacaccaatccacagaatccagagaggagc
ttgaaatttgacggcatgtggattgatatgaatgagccagcgagctttgtgaatggagca
gttcctccaggctgcaaggatgccactctgaaccaccctccctatatgccatatttggag
tccagggacaggggcctgagcagcaagaccctctgcatggagagtgagcaggtcctgcca
gatggctcgcgggtacggcactatgacgttcacagcctgtacggatgggcccagaccaga
cccacctatgaagctgtgcaggaggtgacgggacagagaggcattgtcatcacccgctcc
acgttcccctcttctggccgctggggaggtcactggctgggcgacaacacagctgcctgg
gaccagctgaagaagtctatcattggcatgatggagttcagcctctttggcatatcttat
acaggagcagatatttgtgggttctttcaagatgctgaatatgagatgtgtgttcgctgg
atgcaactgggggccttttaccccttttcgaggaaccacaacaccattgggaccaggaga
caagaccctgtatcctgggatgctgcgtttgtggatatctccagaagtgtgctgctgacc
agatacaccctgttgccgtatctctacaccctgatgcacatggcccacacggagggcagc
actgtcgtgcggcctcttttccacgagtttgtgtcagaccgggtgacctgggatgtagac
agccagtttctgctgggcccagccttcctggtcagccctgtcctggagcctaatgccagc
aatgtcactgcgtatttccctagagcccgctggtatgattactacacgggtgtggacatt
ggagcaaggggagagtggaggtccttggcagcccctcttaaccacattaatcttcatgtc
cgtgggggctacatcctgccctggcaagagcccgcacagaacacccacttaagccgtcag
aaattcataggcttcaaggttgccttggatgatgagggaactgctaatggctggctcttc
tgggatgatggggaaagtattgatacttatggaaaaggactctattacctggccaacttt
tctgccaaccagaatatgatgcagaatcatataattttcaacaaatacatcactgattca
aacccattgaaactgggctacgttgagatctggggagtgggcagtgttcccatttccagt
gtcagcctctctgtgagcagcatggtgataacgccaaactacactaacgaccctgtgaca
caggtgttaagcattgacgtgaccagcagagacatcagcctccataatttcatttcactg
acgtggagaagcactctgtga

DBGET integrated database retrieval system