KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380728
Entry
101380728         CDS       T05148                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X2
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00562  Inositol phosphate metabolism
oro01100  Metabolic pathways
oro01521  EGFR tyrosine kinase inhibitor resistance
oro04012  ErbB signaling pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04020  Calcium signaling pathway
oro04062  Chemokine signaling pathway
oro04064  NF-kappa B signaling pathway
oro04066  HIF-1 signaling pathway
oro04070  Phosphatidylinositol signaling system
oro04072  Phospholipase D signaling pathway
oro04360  Axon guidance
oro04370  VEGF signaling pathway
oro04613  Neutrophil extracellular trap formation
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04670  Leukocyte transendothelial migration
oro04722  Neurotrophin signaling pathway
oro04750  Inflammatory mediator regulation of TRP channels
oro04919  Thyroid hormone signaling pathway
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04935  Growth hormone synthesis, secretion and action
oro05012  Parkinson disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05135  Yersinia infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05170  Human immunodeficiency virus 1 infection
oro05171  Coronavirus disease - COVID-19
oro05200  Pathways in cancer
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05214  Glioma
oro05223  Non-small cell lung cancer
oro05225  Hepatocellular carcinoma
oro05231  Choline metabolism in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
oro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101380728 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101380728 (PLCG1)
   04014 Ras signaling pathway
    101380728 (PLCG1)
   04015 Rap1 signaling pathway
    101380728 (PLCG1)
   04370 VEGF signaling pathway
    101380728 (PLCG1)
   04064 NF-kappa B signaling pathway
    101380728 (PLCG1)
   04066 HIF-1 signaling pathway
    101380728 (PLCG1)
   04020 Calcium signaling pathway
    101380728 (PLCG1)
   04070 Phosphatidylinositol signaling system
    101380728 (PLCG1)
   04072 Phospholipase D signaling pathway
    101380728 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101380728 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    101380728 (PLCG1)
   04660 T cell receptor signaling pathway
    101380728 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    101380728 (PLCG1)
   04659 Th17 cell differentiation
    101380728 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    101380728 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    101380728 (PLCG1)
   04670 Leukocyte transendothelial migration
    101380728 (PLCG1)
   04062 Chemokine signaling pathway
    101380728 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101380728 (PLCG1)
   04919 Thyroid hormone signaling pathway
    101380728 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101380728 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101380728 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    101380728 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101380728 (PLCG1)
   05206 MicroRNAs in cancer
    101380728 (PLCG1)
   05205 Proteoglycans in cancer
    101380728 (PLCG1)
   05231 Choline metabolism in cancer
    101380728 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101380728 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101380728 (PLCG1)
   05214 Glioma
    101380728 (PLCG1)
   05223 Non-small cell lung cancer
    101380728 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101380728 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    101380728 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101380728 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101380728 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101380728 (PLCG1)
   05171 Coronavirus disease - COVID-19
    101380728 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101380728 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101380728 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101380728 (PLCG1)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101380728 (PLCG1)
Membrane trafficking [BR:oro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101380728 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101380728 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 101380728
NCBI-ProteinID: XP_004412025
UniProt: A0A2U3WS24
LinkDB
Position
Unknown
AA seq 1289 aa
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRA
GEQPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMFSFLRDPLREVEEPYFNLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGAPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLW
FPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNSRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFLAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLVKIDVFPAKENGDLSPFSMSLRERGSDASGQLFHGRAREGSFEARYQQPFEDFR
ISHEHLADQSDSRERRAPRRTRVNGDNRL
NT seq 3870 nt   +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgtgccaatggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggccggaacggaagaccttccaggtcaagctggagacgcggcagatc
acgtggagccgtggcgccgacaagatcgagggggccattgacattcgcgaaatcaaggag
atccgccctgggaagacctcacgggattttgatcgctaccaagaagaccctgctttccga
ccagaccagtcacactgctttgtcatcctgtatggaatggaattccgcctgaagaccctg
agcctgcaagctacatctgaggatgaagtgaacatgtggatcaagggtttaacatggctg
atggaggacacattgcaggcagccacacctctgcagattgagaggtggctgcggaagcag
ttctactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcgtctgacggac
ctggagcagcgcagcagtgacatcacctatgggcagtttgctcagctctaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtgccctgagggca
ggggagcagccggagctctgtcgtgtgtcccttcctgagttccagcagttcctcctcgag
taccagggggagctgtgggctgttgaccggcttcaggtgcaggagttcatgttcagcttc
cttcgagatcccttgcgagaagttgaagaaccatatttcaacctggacgagtttgttacc
tttctgttctcgaaagagaacagtgtgtggaactcgcagctggatgccgtgtgcccggac
accatgaacaaccctctctcccactactggatctcttcctcccacaacacgtacctgacc
ggggaccagttctccagcgagtcctccctagaagcctacgctcgctgcctgcgaatgggc
tgtcgctgcattgagttggactgctgggatggcccagatgggatgccagtcatttaccat
ggacacacccttaccactaagatcaagttctcagacgttctgcacaccatcaaggagcat
gccttcgtggcctcagagtacccggtcatcctgtccatcgaggaccactgcagcattgcc
cagcagagaaacatggcacagtacttcaagaaggtgcttggggacacactccttaccaag
cccgtggacatcgccgcggatgggcttccctcacccaaccagctcaagaggaagatcctc
atcaagcacaagaagctggcagagggcagtgcctacgaagaggtgcctacgtcagtgatg
tactccgagaatgatatcagcaactccatcaagaatggcattctctacctggaagacccc
gtgaaccacgagtggtacccccactacttcgttctgaccagcagcaagatctactactct
gaggagaccagcagtgaccagggcaatgaggatgaggaggagcccaaggaggccagtggc
agcacggagctgcactccagtgagaagtggttccatgggaagctcggggcaggacgggat
ggacggcacatcgccgagcgcctgctcaccgagtattgcatcgagacgggggcccctgac
ggctccttcctcgtgcgggagagcgagaccttcgtgggcgactacaccctctctttctgg
aggaacgggaaagtccagcactgccggatccactcccggcaggacgctggggcccccaag
ttcttcttgacagacaacttggtctttgactcgctctatgatctcatcacgcactaccag
caggtgcccctgcgctgcaacgaatttgagatgcgcctctcggagcctgtcccgcagacc
aatgcccacgagagcaaagagtggtaccacgctagcctgaccagagctcaggccgagcac
atgctgatgcgtgtcccccgggacggggccttcctggtgagaaaacggaatgagcccaac
tcctacgccatctccttccgggctgagggcaagatcaagcattgccgtgtccagcaggag
ggccagacggtgatgctgggcaactcggagtttgacagcctcgtggacctcatcagctac
tatgagaagcatccgctgtaccgcaaaatgaagctgcgctaccccatcaatgaggaggcg
ctggagaagatcggcaccgcggagcctgattatggagccctgtatgagggacgcaaccct
ggcttctacgtggaggcaaatcctatgcctactttcaagtgtgcggtcaaagccctcttt
gactacaaggcgcagagggaggacgagctgacattcacgaagagcgccatcatccagaat
gtggagaagcaagatggcggctggtggcggggggactatgggggaaagaagcagctgtgg
tttccgtccaactacgtggaggagatggtcagccctgcagccctggagcctgagagggag
cacttggacgaaaacagccccctgggggacttgctccggggggtcttggatgtgccggct
tgtcagatagccatccgtcccgagggcaagaacagccggctcttcgtcttctccatcagc
atggcttcggtggcacactggtctttggacgtcgctgctgactcccaggaggagctgcag
gactgggtgaagaagatccgagaggtggcccagacagcagacgccaggctcacggagggg
aagatgatggagcgcaggaagaagatcgccctggagctctccgagctggttgtctactgt
cggcccgttcccttcgatgaagagaagattggcacggaacgtgcctgctaccgggacatg
tcatcctttccggagacgaaggcagagaaatatgtgaacaaggccaaaggcaagaagttc
ctccagtacaaccggctgcagctctcccgcatctaccccaagggccagcggctggactcc
tccaactacgaccccttgcccatgtggatctgcggcagtcagctcgtggccctcaacttc
cagaccccagacaagcctatgcagatgaaccaggccctcttcctggccggcggccactgc
ggctatgtgctgcagccgagcaccatgcgggatgaggcctttgatccctttgacaagagc
agcctccgaggtctggagccatgtgccatctgcattgaggtgctgggggcccggcacctg
ccaaagaacggccgaggcatcgtgtgtccttttgtggagattgaggtggccggagcagag
tatgacagcatcaagcagaagacagagtttgtggtggacaatggactgaaccctgtgtgg
cctgccaagcccttccacttccagatcagcaacccggaattcgcctttctgcgctttgtg
gtgtatgaggaagacatgttcagtgaccagaacttcctggctcaggctaccttcccagtg
aaaggcctgaagacaggatacagagccgtgcctttgaagaacaactacagtgaggacctg
gagctggcctccctgctcgtcaagatcgatgttttccctgccaaggagaacggggacctc
agtcccttcagtatgtctctgcgggagaggggctccgatgcttcgggccagctctttcat
ggccgggcccgggaaggttcctttgaagcccgctaccagcagccgtttgaggacttccgt
atctcccacgagcatctggcagaccagtctgacagtcgggaacggagggccccacgacgg
actcgggtcaacggagacaaccgcctctag

DBGET integrated database retrieval system