KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380967
Entry
101380967         CDS       T05148                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00220  Arginine biosynthesis
oro00330  Arginine and proline metabolism
oro01100  Metabolic pathways
oro04020  Calcium signaling pathway
oro04066  HIF-1 signaling pathway
oro04146  Peroxisome
oro04371  Apelin signaling pathway
oro04926  Relaxin signaling pathway
oro05010  Alzheimer disease
oro05014  Amyotrophic lateral sclerosis
oro05022  Pathways of neurodegeneration - multiple diseases
oro05133  Pertussis
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05146  Amoebiasis
oro05152  Tuberculosis
oro05200  Pathways in cancer
oro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101380967 (NOS2)
   00330 Arginine and proline metabolism
    101380967 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101380967 (NOS2)
   04066 HIF-1 signaling pathway
    101380967 (NOS2)
   04020 Calcium signaling pathway
    101380967 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101380967 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101380967 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101380967 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101380967 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101380967 (NOS2)
   05014 Amyotrophic lateral sclerosis
    101380967 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    101380967 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101380967 (NOS2)
   05152 Tuberculosis
    101380967 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101380967 (NOS2)
   05145 Toxoplasmosis
    101380967 (NOS2)
   05140 Leishmaniasis
    101380967 (NOS2)
   05142 Chagas disease
    101380967 (NOS2)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101380967 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 101380967
NCBI-ProteinID: XP_004399692
UniProt: A0A2U3VW76
LinkDB
Position
Unknown
AA seq 1157 aa
MACPWQFLFKAKSYRFDLTEETDINNNVGKASRVPSSLVTQDDPKCHGLGKHRNESPQSL
TGTVKTSPESLIKLDAPPSACPRHVRIKNWGSGMTFQDTLHHKAKGDLACKSKSCLGAIM
NPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKQIETTGTYQ
LTADELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAKEMFEHICRHLRYATNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGTILGDPASVEFTQLCIDLGWKPKYS
RFDVVPLVLQANGQDPEFFEIPPDLVLEVPMEHPKYEWFRELQLKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVIEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHTWQDEKRRPRRRKIPFKVLVKAVFFASMLMRRTMASRVRAT
ILFATETGKSETLARDLGALFSCAFNPKVLCMDEYKLSYLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGD
ELSGQEEAFRSWAVQTFKAACEMFDVRGKHHIQIPKLYTCNVTWDPQHYRLVQDSQPLDL
NKALSSMHAKNVFTLRLKSQRNLQSPQSSRTTLLVELSCEDSHGLSYMPGEHLGVCPGNQ
PALVRRILERVVDGSAPHQPVQLERLSESGSYWVRDKRLPPCSLSQALTYFLDITTPPTQ
VLLRRLAQLATEEAERQRLKILCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRYYSISSSRDRTPTEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKAQDSVPCF
LRSASNFQLPEDPSHPCIFIGPGTGIAPFRGFWQQRLHDTKHKGLQAGRMTLVFGCRRPD
EDHLYREEMLEMAQNGVLHEVHTAYSRLPGQPKVYVQDILRQRLASEVLRVLHEEHGHLY
VCGDVRMARDVAHTLKLLVAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDG
AARQPSDPRVPTAHGRS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagttcttgttcaaggccaaatcctaccggttcgacttgaccgag
gaaacagacatcaacaacaatgtggggaaagccagccgggtcccctccagtctagtgaca
caggatgaccccaagtgtcatggcctcggcaagcaccggaatgagtccccccagtccctc
acagggacggtcaagacgtctccagaatccctgatcaagctggatgcacccccatcggcc
tgcccgcggcatgtgaggatcaaaaactggggcagcgggatgaccttccaagacacactt
caccacaaggccaaaggggatctcgcttgcaagtccaagtcttgtctgggagccatcatg
aaccccaaaagtttgaccagaggacccagggacaagcctacccccccagacgagctccta
cctcaagctattgaatttgtcaaccagtattacggttccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaagcagatagaaacaacaggaacctatcag
ctgacggcggatgagctcatctttgctaccaagcaggcctggcgcaacgccccccgctgc
atcgggaggatccagtggtccaacctgcaggtctttgatgcccggagctgttccactgcc
aaggaaatgtttgagcacatctgcagacacctgcgttatgccaccaacaacggcaacatc
aggtcggccatcactgtgtttccccagcggagcgatgggaagcatgacttccgggtctgg
aatgctcagctcatccggtatgccggctaccagatgccggacggcaccatcctgggggac
cccgccagcgtggagttcacccagctgtgcatcgacctgggctggaagcccaagtacagc
cgcttcgatgtggtgcctctggtgctacaggcgaatggccaagatcctgagttcttcgaa
attccacctgaccttgtgctcgaggtgcccatggaacatcccaagtatgagtggttccgt
gagctgcagctgaagtggtatgccctgcccgcagtggccaacatgctgctcgaggtgggt
ggcctcgagttcccagggtgccccttcaatggctggtacatgggcacagagatcggggtc
cgggacttctgtgacgttcagcgctacaacattctggaggaagtgggcagaaggatgggc
ctggaaacgcacaagctggcctcactctggaaagaccgggctgtcattgagatcaatgtc
gctgtgctccatagcttccagaagcagaatgtgaccatcatggaccaccactcagctgca
gagtccttcatgaagtacatgcagaacgagtaccgctcccgagggggctgcccggctgac
tggatttggctggtacccccgatttctgggagcatcactcccgtgttccaccaggagatg
ttaaactatgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacacc
tggcaggacgagaagcggagaccccggagaagaaagattccattcaaagtcttggttaaa
gctgtgttcttcgcctccatgctgatgcgcaggaccatggcgtcccgagtcagggccaca
atcctctttgcgacggagacaggaaagtcagaaacgctggcccgggacctgggggccttg
ttcagctgtgccttcaaccccaaggtcctctgcatggacgagtacaagctgagttatctg
gaggaggagcagctgcttctggtggtgaccagcacgtttgggaatggagactcccctggc
aatggagagaaactgaaaaaatctctcttcatgctgaaagagcttaccaacaagttcagg
tatgctgtgtttggcctcggctccagcatgtaccctcagttctgtgcctttgctcatgac
atcgaccagaagctgtcccatctgggggcctctcagctcgccccaacaggggaaggggac
gagctcagtggacaggaggaagccttccgcagctgggccgtgcaaaccttcaaggcggcc
tgtgagatgttcgatgtgcgaggcaaacaccatattcagatccccaagctctacacctgc
aatgtgacctgggacccacagcactacaggctcgtgcaggactcgcagcctctggacctc
aacaaagccctcagcagtatgcatgccaagaacgtgttcaccctgaggctcaaatcacaa
cggaatctacagagtccccaatccagccgcaccaccctcctggtggagctctcctgtgag
gacagccacgggctgagctacatgcccggagagcacctcggggtttgcccgggcaaccag
ccggccctggtgcgacgcatcttggagcgagtggtagatggctctgcaccccaccagcct
gtgcaactggagaggctcagtgagagtggaagctactgggtcagagacaagcgactgccc
ccgtgctcactcagccaggccctcacctacttcctggacatcaccaccccccctacccag
gtgctgctccgaaggctggcacagctggctacggaagaggccgagaggcagaggctgaag
atcctgtgccagccctcagaatacaacaagtggaagttcaccaacagccccacatttctg
gaggtgctagaggagttcccatccctgcgggtgtctgctggcttcctactctcccagctc
cctattctgaaaccccggtactactccatcagctcctctagggaccgcacacccacggag
gtccacctcacagtggctgtgctcacataccgcactcgagatggccaaggtcccttgcac
catggtgtctgtagcacatggctcagcagcctgaaggcccaagactcagtaccctgcttc
ctgagaagtgccagcaacttccagctccccgaggacccctcccatccttgcatcttcatc
ggacctggcacaggcattgcccccttccgtggtttctggcagcagcggctccatgacacc
aagcacaaagggctccaggccggccgcatgaccctggtgttcgggtgtcgccgcccagat
gaggaccacctgtatcgggaagagatgttggagatggcccagaatggggtgctgcatgag
gtgcacacagcctattctcgcctgcctggccagcccaaggtctatgttcaagacatcctg
cggcagcggctggccagcgaggtgctccgcgtgctccatgaggagcatggccacctttat
gtctgtggggacgtgcgtatggcccgggatgtggcccataccctgaagctcctggtggct
gccaagctgagcctgagtgaggagcaggtggaggactattttttccagcttaagagccag
aagcgctatcatgaagatatctttggcgctgtgtttccctacgaggtgaaaaaagatggg
gcagcaaggcagcccagcgatcccagagttcccacagcccacgggagaagttaa

DBGET integrated database retrieval system