KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381007
Entry
101381007         CDS       T05148                                 

Gene name
CD37
Definition
(RefSeq) leukocyte antigen CD37
  KO
K06475  CD37 antigen
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101381007 (CD37)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101381007 (CD37)
   04090 CD molecules [BR:oro04090]
    101381007 (CD37)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101381007 (CD37)
CD molecules [BR:oro04090]
 Proteins
  101381007 (CD37)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 101381007
NCBI-ProteinID: XP_004409926
UniProt: A0A2U3WLT3
LinkDB
Position
Unknown
AA seq 304 aa
METWEGPPSVSLVPTNSKAPQAKMSAQDSCLSLIKYLLFVFNLFFFVLGSLIFCFGIWIL
IDKTSFVSFVGLSFVPLQIWSKALAISGILTMGLALLGCVGALKELRCLLGLYFGILLLL
FATQITLGILISTQRMRLERRVKDIVMETIQNYRSRPEESAAEESWDYVQFQLRCCGWNS
PRDWFNIPSLISNESEVHRVPCSCYNSSATNDSAVFDKLSFPQFSRLRPLARPRHSTDLC
VVPANSNIYNEGCARSLQKWLHNNLISIVGICLGVGLLELSFMTLSIFLCRNLDQVYDRL
ARYR
NT seq 915 nt   +upstreamnt  +downstreamnt
atggagacctgggagggaccacccagcgtgtccttggtgcccacaaattccaaggcccct
caggcgaagatgtcggcccaggacagctgcctcagcctcatcaagtacctcctcttcgtt
ttcaacctcttcttcttcgtcctaggcagccttatcttctgctttggcatctggatactc
attgacaagaccagcttcgtgtcctttgtaggcttgtccttcgtgcccctgcagatctgg
tccaaggccctggccatctcaggaattctcaccatgggccttgccctcctgggctgtgtg
ggggccctgaaggagctccggtgcctcctgggcctgtattttgggatactgctgctcctg
tttgccacgcagatcaccctgggaatcctcatctccactcagcggatgcggctggaacgg
agggtgaaggacatcgtgatggagacaatccaaaactaccgctcgcgcccggaggagtcg
gcggcggaagagagctgggactacgtgcagttccagctgcgctgctgcggctggaactct
cctcgggactggttcaatatccccagcctcatcagcaacgagtcggaggtgcatcgcgtg
ccctgctcctgctataattcatcagcgaccaatgactctgcagtcttcgataagctctcg
ttcccccagttcagccggctccgaccactggcgcggccccggcacagtacagacctttgc
gtggttcctgcaaacagcaatatctacaacgagggctgcgcgcggagcctccaaaagtgg
ttgcacaacaacctcatctccatagtgggcatttgtctgggcgtcggtctacttgagctc
agcttcatgacgctctcgatattcctgtgcagaaacctggatcaagtctacgaccggctc
gctcggtaccgctag

DBGET integrated database retrieval system