KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381082
Entry
101381082         CDS       T05148                                 

Definition
(RefSeq) high affinity immunoglobulin gamma Fc receptor I
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04145  Phagosome
oro04380  Osteoclast differentiation
oro04613  Neutrophil extracellular trap formation
oro04640  Hematopoietic cell lineage
oro04666  Fc gamma R-mediated phagocytosis
oro05140  Leishmaniasis
oro05150  Staphylococcus aureus infection
oro05152  Tuberculosis
oro05202  Transcriptional misregulation in cancer
oro05221  Acute myeloid leukemia
oro05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:oro00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101381082
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101381082
   04613 Neutrophil extracellular trap formation
    101381082
   04666 Fc gamma R-mediated phagocytosis
    101381082
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101381082
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101381082
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101381082
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101381082
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101381082
   05152 Tuberculosis
    101381082
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101381082
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oro04131]
    101381082
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oro04090]
    101381082
Membrane trafficking [BR:oro04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    101381082
CD molecules [BR:oro04090]
 Proteins
  101381082
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Adeno_E3_CR1 PPV_E2_N
Other DBs
NCBI-GeneID: 101381082
NCBI-ProteinID: XP_004404226
UniProt: A0A2U3W7M1
LinkDB
Position
Unknown
AA seq 350 aa
MWLLTALLLWVPVGAQTDLAKAVITLQPPWVSVFQEENVNLWCEGPHLPEDTSTQWFLNG
TAIQTLTPRHRIAAASVNDNGEYRCQTGLSVPSDPVQLEVHRDWLLLQVSSTVITEGEPL
TLKCHGWKNKLVYNVLFYQNGKVFRFSSQNSEVTILKTNLSHNGIYHCSGKGRQRYESAG
VSITVKELFPAPVLKASLSSPILEGHLVNLSCETKLLLQRPGLQLYFSFYMGSKTLLSRN
PSSEYQILTFKGEDSGLYWCEATTEDGNVVKRSPELELQVLGLQTQTLVWFHILFYLAVG
MLFLVDTIHCMIIYKELRRKKKWNLEISLDSGQEKRVNSHLQKETYLEEP
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtggctcttgacagctctgctcctttgggttccagttggtgcgcaaacggaccttgca
aaggcagtgatcaccttgcagccgccatgggtcagtgtattccaagaggaaaatgtaaac
ttatggtgtgagggaccccatttacctgaggacacctctacacagtggtttctcaatggc
acagccattcagaccttgacccccagacacagaatagctgctgccagtgtcaatgacaat
ggtgaatacaggtgccagacaggtctctcagtgccaagtgacccagtacagctggaagtc
cacagagattggttactgctccaggtctctagcacagtcatcacagaaggggaacctctg
accttgaagtgtcatggatggaagaataagctggtgtacaatgtgcttttctaccaaaat
ggcaaggtctttaggttttcttctcagaattctgaagtcaccattctgaaaaccaacctg
agtcacaatggcatctatcactgctcaggcaagggaaggcaacgctatgaatcagcagga
gtatctatcactgtaaaagagctatttccagccccagtgctaaaagcatctttgtcatcg
cccatcctggaggggcatctggtcaacctgagctgtgaaacaaagttgctcctacagaga
cctggtttgcagctttacttctccttctacatgggcagcaagaccctgctgagcagaaac
ccatcctctgaataccagatactaacttttaagggagaagattcagggttatactggtgc
gaggcaaccacggaagatggcaatgtcgtcaagcgcagccctgagttggagcttcaagtg
cttggccttcagacacaaactcttgtttggtttcacatccttttctatctggcagtggga
atgctatttttggtggacaccattcactgtatgattatatataaggaactgcgaagaaag
aaaaagtggaatttagaaatctctttggactctggtcaggagaaaagagtaaattcccac
cttcaaaaagagacgtatttagaagagccataa

DBGET integrated database retrieval system