KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381158Help
Entry
101381158         CDS       T05148                                 

Gene name
MGAM2
Definition
(RefSeq) putative maltase-glucoamylase-like protein FLJ16351
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00052  Galactose metabolism
oro00500  Starch and sucrose metabolism
oro01100  Metabolic pathways
oro04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101381158 (MGAM2)
   00500 Starch and sucrose metabolism
    101381158 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101381158 (MGAM2)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101381158 (MGAM2)
    3.2.1.20  alpha-glucosidase
     101381158 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101381158
NCBI-ProteinID: XP_012423605
UniProt: A0A2U3ZXA0
LinkDB All DBs
Position
Unknown
AA seq 2374 aa AA seqDB search
MAKKLSILEVLLIIFFLTVLALDIFLMFFVLKKTEETAFVPECPEIPESERIDCAPGQVV
TEDVCSQQHKCCWKPAPDTNVPWCFFPRNWGYEVSSSKNHTRTGFTAQLKKLPFPSLFGY
DVKNAVFTAEYQTPNRFHFKINDKDNKRYEVPPEIINLSNRTTRTSNLNYHIEVIDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSTAVYGLGEHVHQQYRHNMSWKTWPI
FTRDAAPTKDMINLYGAHTFFLCLEDTSGSSFGVFLLNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVIQEYLELIGRPLLPPYWSLGFQLSRRNYGGISGLKEVVNRNLVAGI
PYDVQYSDIDYMDGNKDFTIDQQAFPDLSDFTNDLHKQGLKYVIIMNPGILNNSDYQPYM
NGRKKRVWILGDNGFVVGQGYPGWTVFPDYSNPTCTQWWTEQFSEFHKTLEFDGVWIEMD
EVTSFLQGSDRGCEWNTLNFPPFTPRILDRLLFARTLCMDVEFQWGFHYDVHSLYGYSMA
KATHSAMENIFPSKSSFILSRSTFAGSGKYAAHWLGENSATWDDLRWSIPSILEFNLFGI
PMVGANICGYTKNVTEELCTRWMQLGAFYPLSRNHNGPGFRDQDPAAFGKHSLLVNSSRY
YLNIRYTLLPYLYTLFYRAHTRGDTVARPLVHEFYQDPATWDVHEQFLWGPGLLITPVLY
EGVDRVKAYIPDAIWYDYETRVAIQWRKQSVEMLLPLDRIGLHLRGGFIFPTQQPNMTTE
ASRKNSLGLIVALDYKREAKGELYWDDGVSKDAEKKYILYDFSVTSNRLQANITNNNYTD
PNNLMFTDIIILGMDKQPTNFTVLLSNSATSISNVAYDVSSKVVKISDLKGLVLGQEFSI
EWKLPVSDLEKFKCYPEDAAVSEESCRLRGCLWEYTAVPDVPTCYYDTIPRYAASNIQYL
PTGITTDLAHLGAPESARAAPASGSLSATISFLQLSVIYHTENMLQFKIFDSTNKRYEVP
VPLNTPPSPVGSPEDRLYDVRIQNNPFGIQIRRKSSSTVIWDSQLPGFTFNDMFLSISTR
LPSQYIYGFGETEHTAFRRNMNWTTWGMFARDEPPAYKKNSYGVHPYYMALEEDGSAHGV
LLLNSNAMDVSFQPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGRPAMTPYWALG
FQLSRYGYQNDTEISQLYEAMMAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLGLLIEQM
KNDGMRFILILDPAISGNETQYRPFTRGQDNNVFIKWPNSNDIVWGKVWPELPNVNVDTS
LDHETQVKLYRANVAFPDFLRNSTAAWWKMEIKELYANSEESEKSLKFDGLWIDMNEPSN
FVDGSVRGCSDEILNNPPYMPYLESRDKGLSSKTLCMESEQVLPDGSRVRHYDVHSLYGW
AQTRPTYEAVQEVTGQRGVIITRSTFPSSGRWGGHWLGDNTAAWDQLRKSIIGMMEFSLF
GIPYTGADICGFFGNAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVAWNSTFEMFSRK
VLQTRYTLLPYLYTLMHKAHTEGSTVVRPLLHEFTNDSKTWDIDRQFMLGPALLISPVLE
SNTFETPAYFPPGRWYDYSTETGNVSTGEWKILDTPLDHINLHIRGGYILPWQEPAMNTH
ASRQKFMGLIVALDDNGKAEGQVFWDDGQSIDTYENGNYFLANFTATQNLLQIQVEHNKY
LSDLNPLKVGYIKIWGISSTFVTQVTFTYDNQQIMEMNFKSDPYNQTLTIQLTDKIISLE
KLTEVTWIYGGPIVSTTPMTSTFPTSSLHPSTVPTKATTFETVITSSAYTSTTLPIPTTA
FSTSATEVTTSTTGRNTTTPFPTSTIDITTSTAVPNTTTPTPTSTIVSSSTLPITSTPFP
TSTSTIVSSSTLPITSTPSPTRTTGVTTSPTVPNTTTPTPTSIIVSSSTLPITSTPFPTG
TTGATTSTTVPNTTTPTPTSTIVSSSTLPITSTPSPTRTTGVTTSTTFPDTTTPSPTSTT
ASTSTLLITGTPFPTSATEVTSSTTVPSTTTPSHISTPTASTSTTLPITSTPFPASTIEV
TTSTAVTNTTVLSPISTASTSTTLPIITTPFPTSNTDASTNTTVRIATTLSPTSTDSTST
NNAVPITTTPSTNSSADSTSNSFPIMTTFSVSTHAMNTTVAMVTTSPISADVVSTGNHTP
ITSSPFPTISGGNSTSNTIPTMSTPSTDIYTISTNTTAVPITNTRNSTGNAVNITDANNS
STVPGNTTHVSIPNTTIALVTILMTALPDTATHYQVTTNSTVSHLPLIATNATTDIINTT
TYALNTTILDRTTMNASATISTYIANVKNATLVP
NT seq 7125 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaactcagtatattggaagtccttctgatcatcttcttcctgactgtactg
gccttagacatcttcttgatgttttttgtgttgaagaaaactgaagagactgcgtttgtt
ccagagtgcccagagatccccgaatcagagaggatagactgtgctccaggccaggtggtg
acagaggatgtctgcagccagcaacataagtgctgctggaaaccggcacccgacactaat
gtcccttggtgcttcttccccaggaactggggctatgaagtcagcagtagcaagaatcat
acaaggacagggtttacagcccagttgaaaaagttgccgttcccatctctgtttggatac
gatgtcaagaacgccgtcttcacagctgaatatcagacacccaatcgttttcattttaag
atcaatgataaggacaacaaacgctatgaagtcccccctgaaattattaacctgtctaat
aggactactagaacctccaatttgaactatcacatagaggtcattgataagcccttcagc
atcaagataatgaggacaagcaacagaagagtcttactggacacgagcatcgggcccctg
cagtttgcccagcagtacctgcagctgtccttccgacttcccagcactgctgtgtacggg
ctgggggagcacgtgcaccagcagtaccgccacaacatgagctggaagacctggcccatc
ttcacgcgcgatgccgcccccaccaaggacatgattaatctgtatggagctcatacattc
ttcctgtgccttgaagacaccagtggctcctcttttggtgtttttctgttgaacagtaat
gccatggaggtcaccctgcagcctgctcctgcgatcacttaccgcacgattgggggcatc
cttgacttttatgtattcctgggaaatactccagaacaagtgattcaggaatacctggag
ctcattggacgaccattgctgcctccctactggagtcttgggttccagcttagtcgcagg
aactatggtggcatcagtggattgaaggaggttgtgaaccgaaatcttgtagctgggatc
ccttatgatgtccagtactctgacatagactacatggatggaaataaggatttcaccatt
gatcaacaagccttccctgatctctcagattttaccaacgacttacataagcaaggactg
aaatatgtaatcattatgaatcctggcatcttaaataactctgactatcagccctatatg
aatggaaggaaaaagagagtatggatcttgggggacaatggctttgtcgttgggcaggga
taccccggatggacggtctttcctgattatagtaatccgacttgcactcagtggtggaca
gagcagttcagtgaatttcataaaactctcgagtttgatggagtgtggattgaaatggat
gaagtaaccagctttctccaaggttctgatcgcgggtgtgaatggaacaccctcaacttt
cctcctttcactccccgaattctggaccgcttgctttttgcaagaaccctctgcatggat
gtagaatttcagtggggctttcactatgatgtccatagcttgtatggctactccatggca
aaagcaacacactcggccatggagaatatcttccccagtaaaagtagcttcatcttatcc
cgctctacttttgctggatctggcaaatatgctgcacattggttgggggaaaactcggcc
acatgggatgacctccgatggtccatccctagtatccttgagttcaacctatttggtatc
cccatggtaggtgccaacatctgtggttacacaaaaaatgtcacagaggagctctgcaca
agatggatgcagcttggagcattttatccactatcaaggaatcacaatgggcctggattc
agggaccaggatcctgccgcctttggtaaacactctctgttggtgaattcttccagatat
tatctgaacatccgatacaccctgctgccctacctctacacccttttctaccgagctcac
acacggggggacaccgtagcgagacccctggtccatgagttctaccaggacccagctact
tgggatgtgcacgagcagttcttatgggggcctggactcctcatcacacctgttttatat
gagggtgtggaccgagtgaaagcatacataccggacgccatctggtacgactatgagaca
cgggtagccatccagtggaggaaacaatcggtggagatgctgctgccactcgataggata
ggacttcacctccgagggggcttcatatttcctacccaacaacccaacatgaccacagag
gccagtcgaaagaattccctgggactcattgttgccttggactacaagagagaggcaaag
ggcgagctgtactgggatgatggtgtatctaaagatgctgaaaagaagtatattctgtat
gatttttctgtcacctctaaccgtctacaggcaaatattacaaataataactatacggac
cctaacaacctcatgtttacagatatcataatcttgggaatggacaagcaacctaccaat
tttaccgtcttacttagtaattctgccacctccatttcaaatgttgcctacgatgtttca
tcaaaggtggtgaagatcagtgatctcaagggactggtactcggtcaagaattctccatt
gaatggaaacttccagtcagtgacctggagaaattcaaatgctaccctgaggatgctgct
gtctctgaggagagttgtaggctgcgggggtgcctttgggagtacacagctgttcctgat
gtgcccacctgttactatgacaccatccctaggtatgccgccagtaacattcagtacctg
cctacgggcatcaccacagaccttgcccacctgggggccccggaatcagcccgagcagcc
cctgcctctggctctctctctgcaacaatcagtttcctccagctgagcgtgatctaccac
acagaaaacatgctgcagttcaagatctttgattccacgaacaaaaggtacgaggtccca
gtgcctctgaacacccctccctctccagttggctcccctgaagaccgtctgtatgacgtc
aggattcagaacaatccttttgggatccagattcggcgaaaaagctccagcactgtgatc
tgggattctcagctgcctggcttcaccttcaacgacatgttcctctccatttctactcgc
ctcccctctcagtacatctatggctttggggagacagagcacacagctttcagaagaaat
atgaactggaccacgtggggaatgtttgctcgtgatgagcccccagcgtataagaagaat
tcctatggcgtccacccctactacatggcactggaggaggatggcagtgcccatggggtg
ctcctgctaaacagcaatgccatggatgtgtcattccagcccactcctgccctaacatac
cgcaccacaggagggattttggacttttatatggttttggggccaacccctgagcttgta
actcaacaatacactgagttgattggtcggccagcaatgactccatactgggccttggga
ttccagctaagtcgctacggataccagaatgatactgagatctctcaattgtatgaggca
atgatggcggcccagattccctatgatgtccagcatgtagacatcgattacatggaccgg
aagctggacttcactctcagccccagcttccaaaacctcggcctcctgattgagcaaatg
aagaatgatggcatgagattcattctcattctggacccagccatttctggcaatgagacc
cagtatcgcccattcaccagagggcaggataacaatgtattcatcaaatggcccaacagc
aatgacattgtctggggaaaggtttggccagaactgcccaatgtgaatgtggatacatcc
cttgaccatgaaactcaggttaagctgtacagagccaacgttgcttttcctgacttctta
cgtaatagcacagccgcatggtggaagatggaaataaaagagctgtatgcgaattctgaa
gagtcagagaagagcttaaagtttgatggattgtggattgatatgaatgagccatcaaac
tttgtggatggatctgtcaggggctgcagcgatgaaattcttaataatccaccctatatg
ccatatttggagtccagggacaagggcctgagcagcaagaccctgtgcatggagagtgag
caggtcctgccagatggctctcgggtgcggcactacgacgttcacagcctgtacggatgg
gcccagaccagacccacctacgaagctgtgcaggaggtgacgggacagcgaggggtcatc
atcacccgctccacattcccctcttctggccgctggggaggccattggctgggcgacaac
acggccgcgtgggaccagctgaggaaatcgatcattggcatgatggagttcagtctcttt
ggaataccgtatacaggagcggatatttgtggcttctttggaaatgctgaatatgagatg
tgtgttcgctggatgcaactgggggccttttaccccttttccagaaaccacaacaccatc
gggacaaggagacaagatcctgtggcctggaattccaccttcgagatgttctccagaaaa
gtccttcagaccagatacaccctgctgccctacctctacactttgatgcataaagctcac
actgagggcagcactgtcgtccgaccccttctccatgagtttacgaatgacagcaaaaca
tgggatatagaccgtcagttcatgttgggtcctgccctcttaatcagccccgtgctggaa
agtaacacttttgagacccctgcttattttcccccaggccgctggtatgactacagcacg
gaaactggcaatgtgtcgacaggtgagtggaaaatcctggacactccccttgaccacatc
aaccttcatatcagaggaggctacatcctgccttggcaagagcctgcgatgaacactcac
gccagtcgacaaaaatttatgggattgattgttgcattggacgacaatgggaaagctgaa
ggccaggtattctgggatgatggacaaagcattgatacctatgaaaatggaaactatttc
ttggcaaactttacagcaactcagaatctattgcaaatccaggtcgaacacaataagtat
ttgagtgacttgaatccactgaaagttggatatattaaaatctgggggataagctctact
tttgtgacacaagtcactttcacctatgacaaccagcaaatcatggagatgaatttcaag
agtgatccttataatcagacgctgactattcaactgactgacaagattattagcctagaa
aagctaactgaggttacttggatatacggtggccctatagtttctactacacctatgaca
agtaccttcccaacaagttctctacatccttctacagttcctactaaggctaccactttt
gagactgttatcactagttctgcttacactagtaccactcttcctattccaaccactgct
ttctcaacaagtgctactgaagttacaactagtactacaggccgtaataccactacacct
ttcccaacaagtactattgacattacaactagcactgctgttcctaataccactacacct
acccccacaagtactatcgttagtagtagtactcttcctatcacaagcactcctttccca
acaagcacaagcactatcgttagtagtagtactcttcctatcacaagcactccttcccca
acacgtactactggagttaccactagtcctactgttcctaataccactacacctaccccc
acaagcattatcgttagtagtagtactcttcctatcacaagtactcctttcccaacaggt
actactggagctaccactagtactactgttcctaataccactacacctacccccacaagt
actatcgttagtagtagtactcttcctatcacaagcactccttccccaacacgtactact
ggagttaccactagtactacttttcctgatactactacaccttcccccacaagcactact
gctagtactagtactcttcttatcacaggcactcctttcccaacaagtgctactgaagtt
acgagtagtactactgttcctagtaccactacaccatcccatataagtacccctactgct
agcactagtactacccttcctatcacaagcactcccttcccagcaagcactattgaagtt
acaactagtactgctgttactaataccactgtgctttcccctataagtactgctagcact
agtactactcttcctatcataaccactcctttcccaacaagtaatactgatgctagcacc
aatactactgttcgaattgccactactctttctccaacaagcactgatagtactagcacc
aataatgctgttccaattacaactactccttctacaaatagtagtgctgatagtactagc
aatagttttcctattatgactactttttctgtaagtactcatgctatgaacactactgtt
gctatggtaaccacttctcctataagtgctgatgttgttagcactggcaaccatactcct
attaccagttctcctttccctacaatatctggtggtaatagtactagtaatactattcct
acaatgtctactccttctacagatatttacactattagcacgaataccacagctgtcccc
atcaccaatacccgaaatagtacagggaatgcagtaaatattaccgatgcaaataactct
agcactgttccaggtaacaccacacatgtttctattccaaataccacaatagcattagtt
actattttaatgaccgctcttccagacacagcaactcactatcaggtaacaacaaactct
acagtcagtcatttacctcttattgcaactaatgctaccaccgatattataaatactacc
acatatgctctaaatactaccattcttgatagaacaacaatgaatgcttctgctaccata
tcaacttatattgcaaatgtcaaaaatgctactctagttccatga

DBGET integrated database retrieval system