KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381225
Entry
101381225         CDS       T05148                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01523  Antifolate resistance
oro04010  MAPK signaling pathway
oro04014  Ras signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04064  NF-kappa B signaling pathway
oro04066  HIF-1 signaling pathway
oro04071  Sphingolipid signaling pathway
oro04137  Mitophagy - animal
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04211  Longevity regulating pathway
oro04218  Cellular senescence
oro04380  Osteoclast differentiation
oro04620  Toll-like receptor signaling pathway
oro04621  NOD-like receptor signaling pathway
oro04622  RIG-I-like receptor signaling pathway
oro04623  Cytosolic DNA-sensing pathway
oro04625  C-type lectin receptor signaling pathway
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04662  B cell receptor signaling pathway
oro04668  TNF signaling pathway
oro04722  Neurotrophin signaling pathway
oro04917  Prolactin signaling pathway
oro04920  Adipocytokine signaling pathway
oro04926  Relaxin signaling pathway
oro04931  Insulin resistance
oro04932  Non-alcoholic fatty liver disease
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro05010  Alzheimer disease
oro05022  Pathways of neurodegeneration - multiple diseases
oro05030  Cocaine addiction
oro05132  Salmonella infection
oro05133  Pertussis
oro05134  Legionellosis
oro05135  Yersinia infection
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05145  Toxoplasmosis
oro05146  Amoebiasis
oro05152  Tuberculosis
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05163  Human cytomegalovirus infection
oro05164  Influenza A
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05167  Kaposi sarcoma-associated herpesvirus infection
oro05168  Herpes simplex virus 1 infection
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05200  Pathways in cancer
oro05202  Transcriptional misregulation in cancer
oro05203  Viral carcinogenesis
oro05212  Pancreatic cancer
oro05215  Prostate cancer
oro05220  Chronic myeloid leukemia
oro05221  Acute myeloid leukemia
oro05222  Small cell lung cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05321  Inflammatory bowel disease
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101381225 (RELA)
   04014 Ras signaling pathway
    101381225 (RELA)
   04064 NF-kappa B signaling pathway
    101381225 (RELA)
   04668 TNF signaling pathway
    101381225 (RELA)
   04066 HIF-1 signaling pathway
    101381225 (RELA)
   04071 Sphingolipid signaling pathway
    101381225 (RELA)
   04024 cAMP signaling pathway
    101381225 (RELA)
   04151 PI3K-Akt signaling pathway
    101381225 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101381225 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    101381225 (RELA)
   04218 Cellular senescence
    101381225 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101381225 (RELA)
   04621 NOD-like receptor signaling pathway
    101381225 (RELA)
   04622 RIG-I-like receptor signaling pathway
    101381225 (RELA)
   04623 Cytosolic DNA-sensing pathway
    101381225 (RELA)
   04625 C-type lectin receptor signaling pathway
    101381225 (RELA)
   04660 T cell receptor signaling pathway
    101381225 (RELA)
   04658 Th1 and Th2 cell differentiation
    101381225 (RELA)
   04659 Th17 cell differentiation
    101381225 (RELA)
   04657 IL-17 signaling pathway
    101381225 (RELA)
   04662 B cell receptor signaling pathway
    101381225 (RELA)
   04062 Chemokine signaling pathway
    101381225 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101381225 (RELA)
   04917 Prolactin signaling pathway
    101381225 (RELA)
   04926 Relaxin signaling pathway
    101381225 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101381225 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101381225 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    101381225 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101381225 (RELA)
   05202 Transcriptional misregulation in cancer
    101381225 (RELA)
   05203 Viral carcinogenesis
    101381225 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101381225 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101381225 (RELA)
   05221 Acute myeloid leukemia
    101381225 (RELA)
   05220 Chronic myeloid leukemia
    101381225 (RELA)
   05215 Prostate cancer
    101381225 (RELA)
   05222 Small cell lung cancer
    101381225 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101381225 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101381225 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    101381225 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    101381225 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101381225 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101381225 (RELA)
   04931 Insulin resistance
    101381225 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101381225 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101381225 (RELA)
   05135 Yersinia infection
    101381225 (RELA)
   05133 Pertussis
    101381225 (RELA)
   05134 Legionellosis
    101381225 (RELA)
   05152 Tuberculosis
    101381225 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101381225 (RELA)
   05170 Human immunodeficiency virus 1 infection
    101381225 (RELA)
   05162 Measles
    101381225 (RELA)
   05164 Influenza A
    101381225 (RELA)
   05161 Hepatitis B
    101381225 (RELA)
   05160 Hepatitis C
    101381225 (RELA)
   05168 Herpes simplex virus 1 infection
    101381225 (RELA)
   05163 Human cytomegalovirus infection
    101381225 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101381225 (RELA)
   05169 Epstein-Barr virus infection
    101381225 (RELA)
   05165 Human papillomavirus infection
    101381225 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101381225 (RELA)
   05145 Toxoplasmosis
    101381225 (RELA)
   05140 Leishmaniasis
    101381225 (RELA)
   05142 Chagas disease
    101381225 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101381225 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101381225 (RELA)
Transcription factors [BR:oro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101381225 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 101381225
NCBI-ProteinID: XP_004393991
UniProt: A0A2U3VGT4
LinkDB
Position
Unknown
AA seq 539 aa
MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSTTSVPKPAPQSYPFTPSLSTINF
EEFSPMVFSSGQIPNQTSALAPAPAPILAPAPAPAPAPILAPGLAQAVVPPAPKTTQAGE
GTLSEALLQLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQLLNQGVSVAPHTAEPM
LMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggacgacctgtttcccctcatcttcccgtctgagcctgcccaggcctccggcccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgccggcagtatcccgggcgagaggagcactgataccaccaagacccaccccacc
atcaagatcaatggctacactgggccagggacagttcgcatctccctggtcaccaaggac
ccccctcaccggcctcacccccatgagcttgtggggaaagactgccgggatggcttctat
gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt
gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaacaacaatccc
ttccaagttcccatagaagaacagcgtggagactacgacctgaatgcggtgcgactctgc
ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgtcacctgtcctctct
catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac
cgaaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag
aaagaggacattgaagtatatttcacgggaccaggctgggaggcccgaggctccttttct
caagccgacgtccaccgacaagtggccattgtgttccggacacctccctacgcggacccc
agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc
agcgagcccatggaattccagtacttgccagacacagatgatcgtcaccggattgaggag
aaacgcaaaaggacatacgagaccttcaagagcatcatgaaaaagagtcctttcaatgga
cccaccgacccccggcctccaccccggcgcattgctgtgccttcccgaagcacaacttcc
gtccccaagccagctccccagtcctatccctttacgccatccctcagcaccatcaacttc
gaggagttctcccccatggtcttttcttcggggcagatcccaaaccagacctctgccttg
gccccggcccctgccccaatcctggccccggcccctgccccagcccctgccccaatctta
gccccaggccttgctcaggctgtggtccccccagcccccaagaccacccaggccggggaa
gggacgctgtcagaggccctgctgcagctgcagtttgatgccgacgaagacctgggggcc
ctgctgggcaacagcgctgaccccgccgtgttcacagacctggcatctgtcgacaactct
gagtttcagcagctcctgaaccagggtgtatctgtggccccacacacagccgagcccatg
ctcatggagtaccctgaggcaataacgcgcctggtgacagggtcccagaggccccctgac
ccagctcctgctcccctaggggcctctgggctccccaacggcctcctctcaggggatgaa
gacttctcctccatcgcagatatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system