KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381227
Entry
101381227         CDS       T05148                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101381227 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101381227 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:oro03310]
    101381227 (NR3C1)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101381227 (NR3C1)
Nuclear receptors [BR:oro03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   101381227 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 101381227
NCBI-ProteinID: XP_004413560
UniProt: A0A2U3WVP3
LinkDB
Position
Unknown
AA seq 782 aa
MDSKESLSPPSKEEVSSSVLGRARGNVMDFYKTLRGGATVKVSASSPSLTAASQSDSKHP
RLGVDFSKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
RLLEESIANLSRSTSVAEKPKSSASAAVSAAPTEREFSKTLSDVSSEQQNLKGQTGTNGG
NVKLYTTDQSTFDIWRKKFQDLEFSSGSPEKEASESPWRSDLLIDENCLLSPLAGEDDPF
LLEGNSNEDCKPLVLPDTKPKIKDNGDLILSSPNSVPLPQVKTEKEDFIELCTPGVIKQE
KLGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIP
PIPVGSENWNRCQGSGDDNLASLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATGP
PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPA
CRYRKCLQAGMNLEARKTKKKIKGIQQATPGTSQETSENPANKTIVPATLPQLTPTLVSL
LEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTL
LQYSWMFLMAFALGWRSYRQSSGSMLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELQR
LQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRF
YQLTKLLDSMHDVVENLLNFCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFH
QK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggactccaaggaatcactaagccccccgagtaaagaagaagtctctagcagtgtgctt
ggtcgggcgaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtg
aaggtttctgcttcttcaccctcactcacggctgcttctcagtccgactccaagcatcca
agacttggggttgacttttcaaaaggctcaggaagcaatgcacagcagccagatctgtcc
aaggcggtttcactctccatgggattgtatatgggagagacagaaactaaagtgatggga
aatgacttgggattcccacagcagggccaaatcagcctttcctctggggagacagacttt
cggcttctggaagaaagcatcgcaaacctcagtaggtcgaccagtgttgcagagaagccc
aagagctcagcgtctgctgctgtttctgctgcccccacagagagggagttttcaaaaact
ctatcggacgtgtcttcagaacagcaaaatttgaagggccagactggcaccaacgggggc
aatgtgaagttgtataccacagaccaaagcacctttgacatttggaggaaaaaattccag
gatttggagttttcttctgggtccccggaaaaagaggcgagtgagagtccttggagatct
gacctcttgatagatgaaaactgtttgctttctcctttggcaggagaggatgatccattc
ctcttggaaggaaactcaaatgaggactgtaagcctcttgttttaccggacactaaacct
aaaattaaggataatggagatctgatcctgtcaagccccaacagtgtgccactgccccaa
gtgaaaacggaaaaagaagatttcattgaactctgcacccctggggtaattaagcaggag
aaactgggcccagtttactgtcaggcaagcttttctggggcaaatataattggtaataaa
atgtctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactatgac
atgaatacagcatcgctttctcaacaacaggatcagaagcctatttttaatgtcattcca
ccaattcctgttggttcagaaaattggaataggtgccaaggatctggagatgacaacttg
gcttccttggggactttgaacttctcgggtcgatcggttttttctaatggctattcaagc
cctgggatgagaccagatgtcagctctcctccatccagctcctctgcggcaacgggacca
cctcccaaactctgccttgtgtgctctgacgaagcctcgggctgtcattacggggtcttg
acttgcgggagctgcaaagtattcttcaaaagagcggtggaaggtagacagcacaattat
ctttgtgctggaagaaatgattgtatcattgataagattcgaagaaaaaactgtccagca
tgccgctatcgaaaatgtcttcaagctggaatgaacctggaagctcggaaaacaaagaaa
aagataaaaggaattcagcaggccactccaggaacgtcacaagaaacttctgaaaatcct
gctaacaaaacaatagttcctgcaacattaccacagctcacccctacactggtgtccctg
ctggaggtcattgagcctgaggtgttatacgcagggtatgacagctctgtcccagattcg
acttggcggatcatgaccacactcaacatgttaggtgggcggcaagtgattgcggcagtg
aaatgggccaaggcgataccaggattcaggaacttacacctggacgaccaaatgacccta
ctgcaatattcatggatgttcctcatggcatttgccctggggtggagatcatatagacaa
tcaagtggaagcatgctatgtttcgctccggatctgattattaatgagcagagaatgacc
ctcccctgcatgtatgaccaatgtaaacacatgctgtatgtttcctccgagttacagagg
cttcaggtctcttacgaagagtatctctgtatgaaaaccttattgcttctctcttcagtt
cctaaggaaggtttgaagagccaagagctatttgatgaaattcgcatgacctacatcaaa
gagctaggaaaagccattgtgaagagggaagggaactccagccagaactggcagcgcttt
taccaactgacaaaactcttggactctatgcatgacgtggttgaaaatctccttaacttt
tgcttccaaacatttttggataagaccatgagtattgaattcccagagatgttggctgaa
atcatcaccaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcat
caaaagtga

DBGET integrated database retrieval system