KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381252
Entry
101381252         CDS       T05148                                 

Gene name
PRKCQ
Definition
(RefSeq) protein kinase C theta type isoform X1
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04064  NF-kappa B signaling pathway
oro04140  Autophagy - animal
oro04270  Vascular smooth muscle contraction
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04750  Inflammatory mediator regulation of TRP channels
oro04920  Adipocytokine signaling pathway
oro04931  Insulin resistance
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101381252 (PRKCQ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101381252 (PRKCQ)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101381252 (PRKCQ)
   04658 Th1 and Th2 cell differentiation
    101381252 (PRKCQ)
   04659 Th17 cell differentiation
    101381252 (PRKCQ)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101381252 (PRKCQ)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101381252 (PRKCQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101381252 (PRKCQ)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101381252 (PRKCQ)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101381252 (PRKCQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101381252 (PRKCQ)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101381252 (PRKCQ)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101381252 (PRKCQ)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C zf-RING_9 Kinase-like Zf_RING C1_2 zf-RING-like APH
Other DBs
NCBI-GeneID: 101381252
NCBI-ProteinID: XP_004398286
UniProt: A0A2U3VSV1
LinkDB
Position
Unknown
AA seq 706 aa
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNMDLISETTVELSSLAERCRKNNGKAEIWLELKPQGRMLMNAR
YFLEMSDTKDMSEFETEGFFALHHRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEHIFREGPVEIGLPCSIKGEARLPCVPAPGKKEPQGISWESPLDGMEKMCHRP
EPEPSIERPSVHMKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPYD
CSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFINPGMERLIS
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgtcaccatttcttcgaattggtttgtccaacttcgactgtgggtcctgccagtcatgt
caaggagaggctgttaacccttactgtgctgtgcttgtcaaagaatacgttgaatcggag
aatggacaaatgtatatccagaaaaagccaaccatgtacccgccctgggacagcactttt
gatgcccacatcaacaagggaagagtaatgcagatcattgtgaagggcaagaacatggac
ctaatatccgaaactaccgtcgagctctcctctctggctgagcgatgcaggaagaacaat
gggaaggcagagatatggttagagctgaaacctcaaggccgaatgctaatgaatgcaaga
tacttcctggaaatgagtgacacaaaggacatgagtgaatttgagactgaaggcttcttt
gctttgcatcaccgccgaggagccatcaaacaggccaaagtccaccatgtcaagtgccat
gagttcaccgccacctttttcccacaacccacattttgctctgtctgccatgagtttgtc
tggggtctgaacaaacaaggctaccagtgtcgacagtgtaatgcggcaattcacaagaag
tgtattgataaagttatagctaagtgcacaggatcagctatcaatagccgagaaaccatg
ttccacaaggagaggttcaaaattgacatgccgcatagatttaaagtctacaattacaaa
agcccgaccttctgtgagcactgtgggaccctgctgtggggcctggccaggcaaggactc
aagtgtgatgcatgtggcatgaatgtacatcacagatgccagacaaaggtggccaatctt
tgtggcataaaccagaagctaatggctgaagcgctggcaatgattgagagcactcaacag
gctcgctgcttaagagatactgaacacatcttcagagaaggtccggttgaaattggtctc
ccatgctccataaaaggtgaagcaaggctgccttgtgtaccagcacctgggaaaaaagag
cctcagggaatctcttgggagtctcctttggatggaatggagaaaatgtgtcatcgtcca
gaacctgaaccaagcatagaaagaccgtctgtacatatgaaactaaaaatcgaggatttt
atcttgcacaaaatgttggggaaaggaagttttggcaaggtcttcctagcagagttcaag
aaaaccaatcaatttttcgcaataaaagccttaaagaaagacgtggttttgatggacgat
gatgttgagtgcacgatggtagagaagagagttctctctttggcctgggagcatccattc
ttaacgcacatgttctgtacattccagaccaaggaaaacctcttttttgtgatggagtat
ctcaatggaggagacttaatgtaccacatccaaagctgccacaagtttgatctttccaga
gcaacgttctatgctgctgaaatcattcttggtctgcagttccttcactccaaaggaatt
gtgtacagagacctgaagctagataatatcctgttagacaaagatggacatatcaaaata
gcggactttggaatgtgcaaggagaacatgttaggagatgccaagacaaacactttctgc
ggcacccctgactatatcgccccggagatcttgctgggtcagaaatacaaccattctgtt
gactggtggtcctttggcgttctcctctatgagatgctaattggtcagtcacctttccat
gggcaagatgaagaagagcttttccactccatccgtatggacaatcccttttaccctcga
tggcttgagaaggaggcaaaggaccttctagtgaagctcttcgtgagggaacctgaaaag
aggctgggagtgaggggagacatccgccagcaccctttgtttcgggagatcaactgggaa
gagcttgaacgaaaggagattgacccaccattccggcctaaagtgaaatcaccgtatgac
tgcagcaatttcgacaaagaattcttaaatgagaaaccccggctgtcgtttgcagacaga
gccctgatcaacagtatggaccagaacatgttcagaaacttttccttcattaacccagga
atggagaggttgatatcctga

DBGET integrated database retrieval system