KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381436
Entry
101381436         CDS       T05148                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X2
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04022  cGMP-PKG signaling pathway
oro04141  Protein processing in endoplasmic reticulum
oro04151  PI3K-Akt signaling pathway
oro04211  Longevity regulating pathway
oro04261  Adrenergic signaling in cardiomyocytes
oro04668  TNF signaling pathway
oro04728  Dopaminergic synapse
oro04911  Insulin secretion
oro04915  Estrogen signaling pathway
oro04918  Thyroid hormone synthesis
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro05020  Prion disease
oro05030  Cocaine addiction
oro05031  Amphetamine addiction
oro05034  Alcoholism
oro05161  Hepatitis B
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101381436 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101381436 (ATF6B)
   04022 cGMP-PKG signaling pathway
    101381436 (ATF6B)
   04151 PI3K-Akt signaling pathway
    101381436 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101381436 (ATF6B)
   04915 Estrogen signaling pathway
    101381436 (ATF6B)
   04926 Relaxin signaling pathway
    101381436 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    101381436 (ATF6B)
   04918 Thyroid hormone synthesis
    101381436 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    101381436 (ATF6B)
   04925 Aldosterone synthesis and secretion
    101381436 (ATF6B)
   04927 Cortisol synthesis and secretion
    101381436 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101381436 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101381436 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    101381436 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101381436 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    101381436 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    101381436 (ATF6B)
   05031 Amphetamine addiction
    101381436 (ATF6B)
   05034 Alcoholism
    101381436 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101381436 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101381436 (ATF6B)
   05161 Hepatitis B
    101381436 (ATF6B)
   05163 Human cytomegalovirus infection
    101381436 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101381436 (ATF6B)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101381436 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 101381436
NCBI-ProteinID: XP_004415329
UniProt: A0A2U3X018
LinkDB
Position
Unknown
AA seq 711 aa
MVGGREGKMAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYTGLDDVAEEQTQLFRCP
EQDVPFGSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPS
SQASGVGEVLVVKTESLAPPLCFLGDDPTSPFETVQINVGPTSDDPSDVQTKVEPVSPSS
SINSEASLLSAESPNQAFIGEEVLEVKTESPSPQGCLLRDVLGPPLGGVQISMGPSSDGS
LGKALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQP
EGQAAPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPVSPRMSGEEPPPRRHLLEFSTQEPVQGVKPLQGSPLGPEEPQPSAPGRP
SFRNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAPERQKSQLRKKSPPVKAVPTQPPGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSSAPGNATGGPLPASAAGQARQTSRRPLYLSHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggcgggagggaaagatggcggaactgatgctcctcagcgagattgcggac
ccaacacgttttttcacggacaacttgctgagcccggaggactggggtctgcagaacagc
actttgtacactggcctggatgatgtggcagaggagcagacgcagctcttccgctgccca
gagcaggatgtcccgtttggcagcagctccctggacgtggggatggatgtcagcccccct
gaaccaccttgggaccccctgcctatattcccagatcttcaggtgaagtctgagccatcc
tccccctgctcctcttcctccctcagctccgaatcatcccatctttccacagaaccctcc
agccaggcctctggtgtaggagaggtgctggttgtgaagacagagtccttggcaccccca
ctctgcttcctaggagatgatccaacatccccatttgaaaccgtccagatcaatgtgggt
cccacctctgatgacccctcagatgtccagaccaaggtagaacctgtctctccatcctcc
tccatcaactcggaggcttccctgctctcagcagagtcccccaaccaggcttttatagga
gaggaggtactggaagtgaagacagagtcaccgtcccctcaggggtgtctcctgcgggat
gtcctaggccccccacttggaggtgtccagatcagcatgggcccatcctccgatggctcc
ttaggcaaagccctacccacccggaagccacccctgcagcccaaacctgtggtgataacc
accgtcccgatgccacccagagctgtgcctcccagcaccaccatccttttgcagcccctt
gtccagccacccccagtctccccagttgtcctcatccaaggtgctattcgggtccagcct
gagggacaagctgccccggctccaaggcctgaaaggaagagcattgttccagctcctatg
cctgggaactcctgcccacctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcggcctgccagtcacggaggaagaagaaagagtatctgcagggc
ctggaggcccggctgcaggccgtgctggccgacaaccagcagctccgccgggagaacgct
gccctccggcggcggctggaggccctgctggctgagaacagtgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cctgtcagcatcagtgagcctccttcggctcccgtctctcctcggatgagcggagaggaa
cctccgccccggagacacttgctggagttctcaacgcaagagccagttcagggagttaaa
cccctccagggttcccccctgggccctgaggagccccagcccagtgctccaggccggcca
agtttcaggaacctgacagccttccccgggggtgccaaggagctactgctgagagacctg
gaccagctcttcctctcctctgactgccggcacttcaaccggaccgagtccctgaggctt
gctgatgagctgagcggctgggtccagcgtcaccagagaggccggcggaagatcccccag
agagccccagagagacagaagtctcagctacggaagaagtcgcctccagttaaggcagtc
cccacccaaccccccgggcccccagagagggattctgtgggccagctgcagctgtatcgc
cacccggaccgttcacagccggagttcctggatgcaattgaccgacgagaagacacgttt
tatgttgtgtccttccgaagggaccacttgctgctccccgccatcagccacaacaagacc
tctcggcccaagatgtccctggtgatgcctgccatggctcccaatgagaccctgtcaggc
cggggagccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacggtacccccctcgctccgaaaacagccatcctcg
gccccgggcaatgccacaggtggccccttgccagcttctgcagccggccaggcccgccag
acctcccgccggcccctctacctcagtcacccctga

DBGET integrated database retrieval system