KEGG   Odobenus rosmarus divergens (Pacific walrus): 101381470
Entry
101381470         CDS       T05148                                 

Gene name
IL1R2
Definition
(RefSeq) interleukin-1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04640  Hematopoietic cell lineage
oro05146  Amoebiasis
oro05166  Human T-cell leukemia virus 1 infection
oro05202  Transcriptional misregulation in cancer
oro05215  Prostate cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101381470 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101381470 (IL1R2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101381470 (IL1R2)
  09162 Cancer: specific types
   05215 Prostate cancer
    101381470 (IL1R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101381470 (IL1R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101381470 (IL1R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101381470 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oro04050]
    101381470 (IL1R2)
   04090 CD molecules [BR:oro04090]
    101381470 (IL1R2)
Cytokine receptors [BR:oro04050]
 Interleukin receptor families
  IL1 receptor family
   101381470 (IL1R2)
CD molecules [BR:oro04090]
 Proteins
  101381470 (IL1R2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 I-set Ig_6 V-set Ig_5 Izumo-Ig LPD11
Other DBs
NCBI-GeneID: 101381470
NCBI-ProteinID: XP_004402464
UniProt: A0A2U3W342
LinkDB
Position
Unknown
AA seq 418 aa
MEHLFQDTLLRSAGPEISTSCVLQKLPEKMFIFYMLVMSVSAFTIPPEEHTVAAENCKFL
GKHFKTDFRVEGEPVVLRCPQAQLWLWASVSPYVNVTWHKNDSTRKLPGEEETRMWIQDG
ALWILPALQEDSGTYICTNRNASYCDEMSVELRVFEKTEASLPFISYPQILTLSSSGSLV
CPELSEFTHNKMDAKIQWYKDSVLLDQDNEKFLSVRGTSRLIIQNVSVEDAGYYTCAMTF
THEGMPYNVTRNIELRVNKKEEETIPVIISPHQTILASLGSRLTIPCKVFLGAGTQSTTM
LWWMANNTRIENAYQGGRVTEEQRQEYSENNENYIEVPLVFDPVIREDLNTDFKCLVRNT
LSFQTLRTTVKEATTFSWGTMLAPFSLVCLVLVGIWMHRRCKHRTGKAHGLITLKTGL
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggaacacctattccaagacaccttgctgcggagtgctggacctgagatctccacctcc
tgtgtcctccagaagttgccagaaaaaatgttcatcttttacatgttggtaatgagtgtt
tcagccttcaccattccgcctgaggaacacacagtggctgccgaaaactgcaaatttctt
ggcaagcatttcaaaaccgacttcagggtagaaggggagcctgtggtcctgaggtgcccc
caggcgcagctctggttgtgggcgtctgtcagcccctatgtcaacgtgacgtggcataaa
aacgattctactagaaagctccccggggaagaagagacgcgaatgtggatccaggatggt
gctctctggatcttgccagccttgcaggaggactcaggcacctacatctgcactaacaga
aatgcctcttactgtgatgaaatgtccgttgagctcagggttttcgagaagacagaagct
tccctgcctttcatatcgtacccgcaaattctaaccttgtcatcctctgggtccttagtt
tgccctgagctgagtgaattcacccataacaaaatggacgcgaagattcagtggtacaag
gattctgtccttttggatcaagacaacgagaagtttctaagtgtgaggggaacctctcgc
ttaatcatccagaatgtgtctgtggaggatgcgggttattacacttgtgccatgacattc
acccatgaaggcatgccgtacaacgtgactaggaatattgaactacgtgtcaacaaaaaa
gaagaggagacaattcctgtgattatctccccccaccagaccatattagcttcactggga
tcaagattgacgatcccgtgtaaggtgtttctgggagccgggacacagtcgaccaccatg
ctctggtggatggccaacaacaccagaatagagaatgcctaccagggaggccgtgtgacc
gaggagcagcgccaggaatactcagagaacaatgagaactacattgaagtgccactggtt
tttgatccagtcataagagaggatttgaacacggattttaaatgccttgtccgtaacaca
ctgagttttcagacgctccgtaccacggtcaaagaagctaccacattctcctgggggacc
atgctggcccccttctccctggtctgcttggttttggtgggaatatggatgcacagacgg
tgtaaacacagaactggaaaagcacatggtttgatcacgttaaagactggcctttaa

DBGET integrated database retrieval system