KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382071Help
Entry
101382071         CDS       T05148                                 

Gene name
TGM5
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 5
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101382071 (TGM5)
Enzymes [BR:oro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101382071 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 101382071
NCBI-ProteinID: XP_004411500
LinkDB All DBs
Position
Unknown
AA seq 719 aa AA seqDB search
MEQGLEVALTDFQSAWNNVQHHTDEISSDRLLVRRGQAFNITLYFRNRGFQPGLDNIIFV
AETGPLPDLSNGTRALFSLTGHHGPSPWIASLETNGASSLEVILCAPPVAAVGRYLLKVH
IDSFQGSVKAYQLGEFILLFNPWCPEDSVYLDSEPQRQEYVVNDYGFIYQGNKNWILPCP
WNYGQFEDTIIDICLELLDKSLNFQIDPATDCALRGSPIYISRVVCAMINSNDDNGVLNG
NWSENYLDGINPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAIMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDNTGRILENKKKDSVWNFHVWNECWMARKDLPPGYGGWQVLD
ATPQEMSNGLYCCGPASVKAIKEGEVELNYDTAFAFSMVNADCMSWLVYGGKEQKIHRDT
NTVGNFISTKSIQSDERDDITENYKYIEGSPQEREVFLKALQKLKAGRSEDPHQADSQHS
TPEAQSGDGLWRLHTPSLRPSDIFQVSLKFQLLDPPHMGQDINFVLLALNMSLQFKDLKV
NLSAQSLLHDGSPLLPFWQDIAFITLSPEEAKTHCYRIPYSQYSQYLSTDKLIRISALGE
EKSSPEKILVNKIITLAYAGIIINVLGAAVVNQPLSIQVLFSNPLSEHVEDCVLTVEGSG
LFKKQQRVLIGVLEPQHRASIILEIVPFKSGQRQIQVNLRSNKFKDIKGYRNVYVDLRL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagggctagaggtggccctcacagacttccagagcgcctggaacaatgtgcag
caccacacagatgagatcagctctgaccgcctcctggtccgcaggggccaggccttcaac
atcactctgtacttcaggaaccggggcttccagccaggcctggacaatatcatcttcgtg
gctgagactggacccctaccagacctgtccaatgggactcgagccctgttcagcctgaca
ggtcatcatggccccagcccgtggattgcctcactggagaccaacggggccagctccctg
gaggtgatcctgtgcgcccctcctgtggcagctgtgggtcggtatctcttgaaagttcat
attgactctttccagggatctgtcaaagcctaccagcttggggaattcatcctgctcttc
aatccctggtgcccagaggattctgtctacttggacagtgagccccagaggcaggaatat
gtcgtgaatgattatggcttcatttaccaagggaacaagaactggatcctcccatgcccc
tggaactatggacagtttgaagacactatcatagacatctgcctggagctgctagacaag
agcctgaacttccagatcgacccagccacagactgtgccctgcggggaagccccatctac
atcagcagggtggtgtgtgccatgatcaacagcaacgatgacaacggggtgctcaacgga
aactggagtgagaactacttagacggcatcaaccctgcggagtggacgggcagtgtggcc
atcctgaaacagtggcatgccacaggctgccagccggtgcgctacgggcagtgctgggtc
tttgctgccatcatgtgcacagtgatgagatgcctggggatccccacccgtgtgatcacc
aactttgactctggccacgacacagatggaaacctgatcatagatgagtattatgacaac
acgggcaggatcttggagaataagaagaaggacagtgtctggaactttcacgtgtggaat
gagtgctggatggcccgaaaggacctccctcctgggtatggaggctggcaggtgctggat
gccacacctcaggagatgagcaacggcctctactgctgtggccctgcctcagtcaaagcc
atcaaagagggagaggtggagctgaactatgacacagcctttgccttctccatggtgaat
gctgactgcatgtcctggcttgtttacggagggaaggagcagaaaattcaccgggacacg
aatacggttggcaattttatcagcaccaagagcattcaaagtgatgagcgagatgacatc
acagagaactacaaatacatagaaggttccccccaggagagggaggtattcctgaaggct
cttcagaagctgaaggctggaaggtctgaagacccccaccaagcagactcacaacattcc
acacccgaggcacagagtggggacggcctttggaggctgcacacaccttcccttcggccc
agtgatattttccaggtctccttgaaattccagctgctcgacccgccccacatgggccag
gacataaactttgtcctgctggctctcaacatgtcactccagttcaaggacctcaaagtg
aacctgagtgcccagtccctgctgcatgatggcagccccctgctccctttctggcaggat
atagcctttatcacactctctcctgaagaagcaaagacccattgctatagaattccctac
tcccagtatagccagtacctgtcaacagacaagctgatccgcatcagtgccctgggtgaa
gagaagagcagtccggaaaagatcctggtgaacaagatcatcaccttagcctatgcaggc
atcataattaacgttttaggagctgcggttgtgaaccagccactctccatccaggtgctg
ttttcaaaccccctctcagagcacgtggaagactgtgtgctaactgtggaaggaagtggg
ctcttcaagaaacagcagagagtcctcattggagtcctcgaacctcaacacagggccagc
atcatactggagattgttcccttcaagagtggccaaaggcagatccaagtgaatctgagg
agcaacaagtttaaggacatcaagggttacaggaatgtctatgtagacttgaggttataa

DBGET integrated database retrieval system