KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382073Help
Entry
101382073         CDS       T05148                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X3
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00020  Citrate cycle (TCA cycle)
oro00190  Oxidative phosphorylation
oro01100  Metabolic pathways
oro01200  Carbon metabolism
oro04714  Thermogenesis
oro04932  Non-alcoholic fatty liver disease (NAFLD)
oro05010  Alzheimer disease
oro05012  Parkinson disease
oro05016  Huntington disease
Module
oro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
oro_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101382073 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101382073 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101382073 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    101382073 (SDHA)
   05012 Parkinson disease
    101382073 (SDHA)
   05016 Huntington disease
    101382073 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101382073 (SDHA)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101382073 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 101382073
NCBI-ProteinID: XP_004411670
UniProt: A0A2U3WR09
LinkDB All DBs
Position
Unknown
AA seq 664 aa AA seqDB search
MSRVRVVSRLLGARRLALTRAWPATWQTGTRGFHFAVDGNKRSSAKVSDSISTQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVTALCIE
DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLAIRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCEKIS
QLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYRER
IDEYDYSRPIQGQQKKPFEEHWRKHTLSYVDVKTGKVSLQYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagggtccgggtggtgtctcggctgttgggcgcccggcgcctggcactgaccagg
gcgtggccagcaacatggcagacaggcacccgaggttttcacttcgctgttgatgggaat
aagaggtcttcggctaaagtttcagattcaatttctacacagtacccagtagtggaccat
gagtttgatgcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tccgaggctggatttaacacggcctgcgtcacaaagctctttcctaccagatcacacacc
gttgcggcccagggagggatcaatgctgctctggggaacatggaggaagacaactggaga
tggcacttctacgacactgtgaagggctctgactggctgggggaccaggacgccatccac
tacatgacggagcaggctcctgcttccgtggtagagctggaaaattacggcatgccattt
agcagaactgaagatgggaggatttaccagcgtgcttttggcggacagagcctcaagttt
gggaaaggcgggcaggcccaccggtgctgctgtgtggcggaccgcactggccactcactg
ctgcacacgttgtatggaaggtctctgcgatatgataccagctattttgtagagtatttt
gccttggatctcttgatggaaaatggggaatgtcgtggtgttactgcactatgcatagaa
gatgggtccatccatcgcataagagccaagaacactgttgtagctaccggaggctacggg
cgcacctacttcagctgcacatctgcccacaccagcaccggtgacggcaccgccatggtc
accagggcaggccttccctgccaggacttggagttcgttcagttccaccccacaggtata
tacggtgctggttgtctcattacggaaggatgccgtggagagggaggcattctcattaac
agtcaaggcgaaaggttcatggagcgatatgccccggttgcaaaggacctggcgtccaga
gacgttgtgtctcggtccatgactctggaaatccgtgaaggaagaggctgtggccctgag
aaagatcacgtctacctgcagttgcaccacctaccccccgagcagctggccatacgcctg
cctggcatttcagagacggccatgatcttcgcaggcgtggatgtcaccaaggagccgatc
cctgtccttcccactgtgcattataacatgggtggtattcccaccaactacaagggccag
gtcctgaggcatgtgaacggccaggatcagatcgtgcccggcctatatgcctgtggggag
gccgcctgcgcctcggtgcacggtgccaaccgtctcggggcaaactccctcttggacctg
gtcgtctttggccgggcgtgtgctctgagtattgcagagtcctgcagacctggagataaa
gttcccccaattaaaccaaatgccggggaagagtctgtcatgaatcttgacaaattgaga
tttgctgatggaagcataagaacatcagaactgcgactcaacatgcagaagtcgatgcaa
aatcatgctgcagtgttccgggtgggaagtgtgttacaggaaggctgtgagaaaatcagc
cagctctatggagacctaaaacatctgaagacgtttgaccgaggaatggtctggaacact
gacctggtggagaccctggagctgcagaacctgatgctctgtgcacttcagaccatttac
ggggcagaggcccggaaggagtctcgtggtgctcatgccagggaagattacagggagcgg
attgatgagtatgattactccaggcccatccaggggcagcagaagaagccatttgaggag
cactggaggaagcacaccctttcctatgttgatgtcaagactgggaaggtttcgttgcaa
tacagaccagtgatcgacaaaactttaaatgaggctgactgtgccacagtccctccagcc
attcgctcctactga

DBGET integrated database retrieval system