KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382125
Entry
101382125         CDS       T05148                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro03050  Proteasome
oro04060  Cytokine-cytokine receptor interaction
oro04066  HIF-1 signaling pathway
oro04217  Necroptosis
oro04350  TGF-beta signaling pathway
oro04380  Osteoclast differentiation
oro04612  Antigen processing and presentation
oro04630  JAK-STAT signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04940  Type I diabetes mellitus
oro05140  Leishmaniasis
oro05142  Chagas disease
oro05143  African trypanosomiasis
oro05144  Malaria
oro05145  Toxoplasmosis
oro05146  Amoebiasis
oro05152  Tuberculosis
oro05160  Hepatitis C
oro05164  Influenza A
oro05168  Herpes simplex virus 1 infection
oro05200  Pathways in cancer
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05321  Inflammatory bowel disease
oro05322  Systemic lupus erythematosus
oro05323  Rheumatoid arthritis
oro05330  Allograft rejection
oro05332  Graft-versus-host disease
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101382125 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101382125 (IFNG)
   04630 JAK-STAT signaling pathway
    101382125 (IFNG)
   04066 HIF-1 signaling pathway
    101382125 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101382125 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101382125 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101382125 (IFNG)
   04612 Antigen processing and presentation
    101382125 (IFNG)
   04660 T cell receptor signaling pathway
    101382125 (IFNG)
   04658 Th1 and Th2 cell differentiation
    101382125 (IFNG)
   04659 Th17 cell differentiation
    101382125 (IFNG)
   04657 IL-17 signaling pathway
    101382125 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101382125 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101382125 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101382125 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    101382125 (IFNG)
   05323 Rheumatoid arthritis
    101382125 (IFNG)
   05321 Inflammatory bowel disease
    101382125 (IFNG)
   05330 Allograft rejection
    101382125 (IFNG)
   05332 Graft-versus-host disease
    101382125 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101382125 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101382125 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101382125 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101382125 (IFNG)
   05164 Influenza A
    101382125 (IFNG)
   05168 Herpes simplex virus 1 infection
    101382125 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101382125 (IFNG)
   05144 Malaria
    101382125 (IFNG)
   05145 Toxoplasmosis
    101382125 (IFNG)
   05140 Leishmaniasis
    101382125 (IFNG)
   05142 Chagas disease
    101382125 (IFNG)
   05143 African trypanosomiasis
    101382125 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:oro03051]
    101382125 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101382125 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101382125 (IFNG)
Proteasome [BR:oro03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101382125 (IFNG)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interferons
   101382125 (IFNG)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Heparin
  Cytokines
   101382125 (IFNG)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 101382125
NCBI-ProteinID: XP_004416484
UniProt: A0A2U3X2V9
LinkDB
Position
Unknown
AA seq 166 aa
MNYTGYILAFQLCVILCSSGYYCQAMFFKEIENLKEYFNASNPDVADGGPLFLDILKNWR
EESDKTIIQSQIVSFYLKLFENFRDNQIIQRSMDTIKEDMLVKFFNSSNSKRDDFLKLIR
IPVNDLQVQRKAINELIKVMSDLSPRSNLRKRKRSQNLFRGRRASK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaattacacaggctatatcttagcttttcagctttgcgtgattttgtgttcttctggt
tactactgtcaggccatgttttttaaagaaatagagaacctaaaggaatattttaatgca
agtaatccagatgtagcagacggtgggcctcttttcttagacattttgaagaactggaga
gaggagagtgacaaaacaatcattcaaagccaaatcgtctccttctacttgaaactgttt
gaaaactttagagataatcagatcattcaaaggagcatggataccatcaaggaagacatg
cttgtcaagttcttcaatagcagcaacagtaagagggatgacttcctcaagctgattcga
attcccgtgaatgatctgcaggtccagcgcaaagcgataaatgaactcatcaaagtgatg
agtgatctctcaccaagatctaacctaaggaagcggaaaaggagtcagaatctgtttcga
ggccgcagagcatcgaaataa

DBGET integrated database retrieval system