KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382350
Entry
101382350         CDS       T05148                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X2
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00220  Arginine biosynthesis
oro00330  Arginine and proline metabolism
oro01100  Metabolic pathways
oro04020  Calcium signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04066  HIF-1 signaling pathway
oro04071  Sphingolipid signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04370  VEGF signaling pathway
oro04371  Apelin signaling pathway
oro04611  Platelet activation
oro04915  Estrogen signaling pathway
oro04921  Oxytocin signaling pathway
oro04926  Relaxin signaling pathway
oro04931  Insulin resistance
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101382350 (NOS3)
   00330 Arginine and proline metabolism
    101382350 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101382350 (NOS3)
   04371 Apelin signaling pathway
    101382350 (NOS3)
   04066 HIF-1 signaling pathway
    101382350 (NOS3)
   04020 Calcium signaling pathway
    101382350 (NOS3)
   04071 Sphingolipid signaling pathway
    101382350 (NOS3)
   04022 cGMP-PKG signaling pathway
    101382350 (NOS3)
   04151 PI3K-Akt signaling pathway
    101382350 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101382350 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101382350 (NOS3)
   04921 Oxytocin signaling pathway
    101382350 (NOS3)
   04926 Relaxin signaling pathway
    101382350 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101382350 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101382350 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101382350 (NOS3)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101382350 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 101382350
NCBI-ProteinID: XP_004408863
UniProt: A0A2U3WJA4
LinkDB
Position
Unknown
AA seq 1207 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPTSSEPSRAPAPAPAPTPAPPPAPDLS
PPLTRPPDGPKFPRVKNWEVGSITYDTLSAQSQQDGPCTPRRCLGSLVFPRKLQSRPSQD
PPPPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQ
AWRNAPRCVGRIQWGKLQVFDARDCSSAQEMFTYICNHIKYATNRGNLRSAITVFPQRAP
GRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNSRFDVLPLLLQAP
DEPPELFALPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGW
YMSTEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVT
IVDHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQ
PDPWKGSASKGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQ
QLGRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGP
YNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRA
YPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGQDA
KAAARDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATVLSVENLQSSKSTR
ATILVRLDTGGQEALQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPGEPVAVEQLEKGS
PGGPPPSWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEESSEQQELESLSQD
PRRYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHPGEIHLT
VAVLAYRTQDGLGPLHYGVCSTWLSQLKGGDPIPCFIRGAPSFRLPPDPSLPCILVGPGT
GIAPFRGFWQERLHDIDSKGLQPAPMTLVFGCRCSQLDHLYRDEVRDAQQRGVFGRVLTA
FSREPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGD
MELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHLRGAVPWAFDPP
GPDTPSP
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcccgggcccccatgtggcctggggctgggc
ctgggcctggggctgtgcggcaagcagggccctgcctccccgacctcctcagagcccagc
agggcacccgcacccgcacccgcacccacacccgcacccccaccagcaccagacctcagc
cccccgctcacccggccaccggacgggcccaagttccctcgtgtgaagaactgggaggtg
gggagcatcacctacgacaccctaagtgcccagtcacagcaggatgggccctgcaccccc
agacgctgcctgggctctctggtatttccacggaaactgcagagccggccttctcaggac
cctccaccccctgagcagctgctgagccaggccagggacttcatcaaccagtactatagc
tccatcaagaggagcggctcccaggcccatgagcagaggcttcaggaggtggaagcggag
gtagcagccacgggcacctaccagcttcgggagagtgagctggtgttcggggccaagcag
gcctggcgaaatgctccccgctgtgtgggccggatccagtgggggaagctgcaggtgttc
gatgcccgggattgcagctctgcccaggagatgttcacctacatctgcaaccacatcaag
tatgccacgaaccggggcaacctccgctcggccatcacagtgttcccccagcgcgcccca
ggccgcggagacttccgaatctggaacagccaactggtgcgctatgcgggctacaggcag
caggacggctcggtgcggggggacccagccaacgtggagatcactgagctctgcatccag
cacggctggaccccaggaaacagccgctttgatgtgctgcccctactgctccaggcccca
gatgagcccccagaactctttgctctgccccccgagctggtcctcgaggtgcccctggaa
caccccacgctggagtggtttgcggccctgggcctgcgctggtatgccctcccagcggtg
agcaacatgctactggaaatcgggggactggagttccctgcagcccctttcagcggctgg
tacatgagcactgagattggcacgcggaatctgtgtgaccctcaccgatataacattctg
gaggatgtggcggtctgcatggacttggataccaggacaacctcatcgctgtggaaagac
aaggcagcggtggaaatcaacttggccgtgctgcacagttaccagctggccaaagtgacc
atcgtggaccaccatgctgccaccgcctccttcatgaagcacctggagaacgagcagaag
gctagggggggctgccctgccgactgggcctggatcgtgccccccatctctggcagcctc
acccctgtcttccatcaggagatggtcaactatgtcctgtccccggccttccgctatcag
ccagacccgtggaaggggagtgcatccaagggtgccggcatcaccaggaagaagaccttc
aaggaagtggccaatgcagtgaagatctctgcctcactcatgggcaccgtgatggcaaag
cgagtgaaggcgaccatcctgtatggctccgagaccggccgggcccagagctacgcccag
cagctggggagactcttccggaaggctttcgaccccagggtcctgtgcatggatgagtac
gatgtggtgtcccttgagcatgagacactggtgttggtggtgaccagcacatttgggaat
ggtgatcccccagagaatggagagagttttgcggcggccctgatggagatgtccggcccc
tacaacagttcccctcggccagaacagcacaagagttacaaaatccgcttcaacagcgtc
tcctgctcagacccgctggtgtcctcctggaggcggaagagaaaggagtccagtaacaca
gacagtgcaggggccctgggtaccctcaggttctgtgtgttcggcctgggctcccgggca
tacccccacttctgcgccttcgctcgtgcggtggacacacggctagaagagctgggcggg
gagcggctactgcagctgggccagggagatgagttgtgtggccaggaggaggccttccgt
ggctgggcccaggccgccttccaggcctcctgtgagactttctgtgtgggacaggatgcc
aaggccgccgcccgggacatattcagccccaaacggagctggaagcgccagaggtaccgg
ctgagtgcccaggcggagggcctccagctgctgccaggcctgatccacgtgcacaggagg
aagatgttccaggctacggtcctttcagtggaaaacctgcaaagcagcaagtccacccgg
gccacgatcctggtgcgcctagacactggaggccaggaggcgctgcagtaccagccaggg
gaccacataggtatctgcccgcccaaccggcccggcctcgtggaggcgctgctgagccgc
gtggaggacccgcctccaccaggagagcccgtggccgtggagcagctggagaagggcagc
cctggtggaccgccccccagctgggttcgggacccccggctgcccccatgcacgctgcgc
caggctctcaccttcttcctggacatcacttccccgcccagccctcaactccttcgactg
ctcagcaccctggccgaagagtccagcgaacagcaggagctcgagagcctcagccaggac
ccgcggcgctacgaggagtggaagtggttccgctgccccacgctgctggaggtgctggag
cagttcccatcggtggcactgccagcccccctgctcctcacccagctgcccctgctccag
ccccggtactactcggtcagctcagcacccagcgcccacccaggagagatccacctcaca
gtagccgtgctggcatacaggacgcaggatggactgggcccccttcattatggagtctgc
tccacgtggctgagccaactgaagggtggagatcccataccctgcttcatcaggggggct
ccctccttccgactgccgcccgatcccagcttgccctgcatcctagtgggccctggcaca
ggtattgcccccttccggggattttggcaggagcggctgcacgacattgacagcaaaggg
ctgcagcccgcccccatgactttggtgttcggctgccgatgctcccagctcgaccacctt
taccgcgacgaggtgcgggatgcccagcagcgcggagtttttggccgcgtcctcaccgcc
ttctcccgggagcccgacagccctaagacctacgtgcaggacatcctgcggaccgagctg
gctgctgaggtgcaccgcgtgctgtgcctcgagcggggccacatgtttgtgtgcggcgac
gtcaccatggcaaccagcgtcctgcagacggtgcagcgaatcctagcgacggagggcgac
atggagctggacgaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctatcac
gaggacattttcgggctcacactgcgcactcaggaggtgacaagccgcatacgcacccag
agcttttccttgcaggagcgacatctgcggggcgcagtgccctgggcgttcgacccgcct
ggcccggacacccccagcccctga

DBGET integrated database retrieval system