KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382544Help
Entry
101382544         CDS       T05148                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04614  Renin-angiotensin system
oro04924  Renin secretion
oro05142  Chagas disease (American trypanosomiasis)
oro05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    101382544
   04614 Renin-angiotensin system
    101382544
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101382544
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    101382544
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oro01002]
    101382544
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101382544
   04090 CD Molecules [BR:oro04090]
    101382544
Enzymes [BR:oro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101382544
Peptidases [BR:oro01002]
 Metallo Peptidases
  Family M2
   101382544
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101382544
CD molecules [BR:oro04090]
 Proteins
  101382544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 CopD
Motif
Other DBs
NCBI-GeneID: 101382544
NCBI-ProteinID: XP_004405959
UniProt: A0A2U3WBY5
LinkDB All DBs
Position
Unknown
AA seq 772 aa AA seqDB search
MELDRDWSIASPSSAVLLAMDTRWTCHGPSLFVLFCYGQLLPWLRTEGDQSLDEFYNETV
AKAFLQFYEHTTQVVWNEFMEATWNYATNITKKNWEEMLHKDSERSQHMLYFGTRARLFK
TSRFHDVAVKRMLSKLQNIDKAALPQDELREYNKLLAYMETTYSMAQVCLNEGPCLPLEP
DLQEVMATSQDQKELLWAWQGWRDAVGRQLRITFERYVQLSNKAAKLNGYKDMGALWRSK
YESDSLEQDLEQLYQELQPLYLNLHAYVRRALHHHYGPELIDPRGPIPAHLLGNMWAQSW
VNILDLVLPFPRKPPEDITKIMKSQHWKPSKMFEEADKFFTSLGLLSAPPDFWKKSMMER
PADGREVECHASAWDFYNGKDFRIKKCTEVTIEDLLSIFHQMGHIQYFLQYKNLSVIFRA
GANPAFEEAVGSMITLSVSSHKHLLNRGLLSHQHQDSEEEVNFLMGIALEKIAFIPFAYL
MDLFRWKVFDGTIRKDAYNQEWWNLRLKYQGLCPPVPRTEEDFDPGAKFHISASMPYIQY
FISLVLQFQLHEALCKASGHVGPPHQCDIYNSKMAGKLLEDILKLGSSKPWPEVLQKITG
QTEVSTKALMTYFKPLLNWLVTENVRQGEILGWPDFSCTFEGKDTDKVTFLSLELDPDQA
KFGQWVLLALSLVMFLVALLLAHRLYSLEKRSLSQDTDAQDTSSRDSSAPEAQPKAYFLG
VAMESRLVAKKQWILLGFCLILTLCSIILTIRIFTQHYRKPLWMRAEWWSWD
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaccgtgattggtccatagcctcacccagctctgctgttctcttggccatg
gacacaagatggacttgccatggaccttctctatttgtcctcttctgttatgggcagctc
ttgccatggctcaggaccgagggtgatcagagcttagacgagttctacaatgagaccgtg
gcaaaggcgttcctgcagttttatgagcataccacccaggttgtgtggaacgagttcatg
gaggccacgtggaactatgccaccaacatcaccaagaaaaattgggaggagatgctgcac
aaggactcagagaggtcccagcacatgctgtactttggcacccgggcccgcctgtttaag
acctccaggttccacgatgtggccgtgaagcgtatgctgagtaagctgcagaacatagac
aaggcagccctgccccaggacgagctccgggagtacaacaagcttctggcctacatggag
acgacatacagcatggcccaggtgtgcctgaatgagggaccctgcctgcccctggagcct
gacctccaagaagtcatggccacctcccaggaccagaaggagctgctgtgggcctggcag
ggctggcgggatgctgtgggtcgtcagcttcgcatcacctttgagcgctacgtgcagctc
agcaacaaggctgcaaagctcaacggttacaaagacatgggggccttgtggcggtccaag
tatgagtccgactcgctagaacaggatctggagcagctttaccaggagctgcagccgctc
tacttgaacctgcacgcctacgtgcgccgggccctgcaccaccactacgggcccgagctt
atcgacccgagggggcccatccctgctcacctgctggggaacatgtgggctcagtcctgg
gtcaacatcttagacctggtcctgcccttcccgaggaagccccctgaggatatcacgaag
atcatgaaaagccagcactggaagccctccaaaatgttcgaagaggcggacaagttcttc
acctccctggggctgctttccgcccctcccgacttctggaaaaaatcaatgatggaaagg
ccagccgatggacgggaggtggagtgccacgcctccgcctgggacttttacaacggcaag
gacttcaggataaagaagtgcaccgaggtgaccatagaagacctgctctccatcttccac
cagatgggccacatccagtacttcttgcagtacaagaacctctctgtgatcttccgcgca
ggcgccaacccagcctttgaagaggccgtggggtcgatgatcaccctctcggtctcctcc
cacaagcacctgctcaacagaggcctgctcagccaccagcaccaggactcagaggaggag
gtcaatttcctgatgggcattgccctggagaagatcgccttcatccccttcgcctacctg
atggacctgtttcgctggaaggtctttgatggcaccatccggaaggacgcttacaaccag
gagtggtggaacctcaggttgaagtaccagggcctgtgcccccccgtccctcggacagag
gaagactttgaccccggcgccaagttccacatctctgccagcatgccctatatacagtac
ttcatcagccttgtgctccagttccagctccacgaagctttgtgcaaggcctcgggtcac
gtgggcccaccacaccagtgtgacatctataactccaagatggctgggaagctcctggaa
gatatcctaaagctgggctcaagcaagccctggccagaagtcctgcagaagataactggg
cagactgaagtgtccacaaaggccctcatgacctacttcaaacccctgctgaactggctg
gtcactgagaacgtgcggcagggggagatcctgggctggccagacttcagctgtaccttt
gaaggaaaagacacagacaaagtgacatttctgagtctggagctggaccctgaccaggcc
aaatttgggcagtgggtgttgctggccctcagcttggtcatgttcctggtggccctactg
ctggcccacaggttgtactccctggaaaaaaggtcactgtcccaggacactgatgcccag
gacaccagttcacgggactccagtgcccctgaggcacagcccaaggcctacttcctgggt
gtggccatggagtcccgcctagttgccaaaaaacagtggatcctgctgggcttctgcctc
atcctgacgctgtgctcaatcatcctgaccattcggattttcacacagcactacaggaag
cctctgtggatgagagctgaatggtggagctgggactag

DBGET integrated database retrieval system