KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382563
Entry
101382563         CDS       T05148                                 

Gene name
CD40LG
Definition
(RefSeq) CD40 ligand isoform X1
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04064  NF-kappa B signaling pathway
oro04514  Cell adhesion molecules
oro04660  T cell receptor signaling pathway
oro04672  Intestinal immune network for IgA production
oro05144  Malaria
oro05145  Toxoplasmosis
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05322  Systemic lupus erythematosus
oro05330  Allograft rejection
oro05340  Primary immunodeficiency
oro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101382563 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101382563 (CD40LG)
   04514 Cell adhesion molecules
    101382563 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101382563 (CD40LG)
   04672 Intestinal immune network for IgA production
    101382563 (CD40LG)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    101382563 (CD40LG)
   05322 Systemic lupus erythematosus
    101382563 (CD40LG)
   05320 Autoimmune thyroid disease
    101382563 (CD40LG)
   05330 Allograft rejection
    101382563 (CD40LG)
   05340 Primary immunodeficiency
    101382563 (CD40LG)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101382563 (CD40LG)
  09174 Infectious disease: parasitic
   05144 Malaria
    101382563 (CD40LG)
   05145 Toxoplasmosis
    101382563 (CD40LG)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Tumor necrosis fators
   101382563 (CD40LG)
CD molecules [BR:oro04090]
 Proteins
  101382563 (CD40LG)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 101382563
NCBI-ProteinID: XP_004410535
UniProt: A0A2U3WNH1
LinkDB
Position
Unknown
AA seq 260 aa
MIETYSQTAPRSVATGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLY
EDFVFMKTLQKCNKGEGSLSLLNCEEIKSRFEAFLKEIMLNKEVKKEESVAMQKGDQDPQ
IAAHVISEASSNTVSVLQWAPKGYYTISSNLVTLENGKELAVKRQGLYYIYAQVTFCSNR
ETSSQAPFIASLCLNSPSGSKRVLLRAANTRSSSKPCGQQSIHLGGVFELHPGASVFVNV
TDPSQVSHGTGFTSFGLLKL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgatcgaaacatatagccaaactgctccccgatccgtggccaccggaccacccgtcagt
atgaaaatttttatgtatttacttactgtttttctcatcacccagatgattgggtcagca
ctctttgctgtgtatcttcacagaagattggacaagatagaagatgaaaggaatctttac
gaagattttgtgttcatgaaaacgttacagaaatgcaacaaaggagaggggtccttgtcc
ttactgaactgtgaggaaattaaaagccggtttgaagcctttctcaaggagataatgcta
aacaaagaagtgaagaaagaagaaagtgttgcgatgcaaaaaggtgatcaggatcctcaa
attgcagcccatgtcataagtgaggccagtagtaacacagtgtccgttctccagtgggcc
ccgaaaggatactacaccataagcagcaacctggtaaccctcgaaaatgggaaagagctg
gccgtgaaaagacaaggactctattacatctatgcccaagtcaccttctgttccaatcgg
gaaacttcgagtcaagctccatttatagctagcctctgcctgaattccccgagcggatcc
aagagagtcttactcagggctgcaaacacccgcagctcctccaaaccttgcgggcaacaa
tccatccacttgggaggagtatttgaattgcatccaggtgcttcggtgttcgtcaacgtg
actgatccaagccaagtgagccacgggacgggcttcacgtcttttggcttactcaaactc
tga

DBGET integrated database retrieval system