KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382716Help
Entry
101382716         CDS       T05148                                 

Gene name
IL1A
Definition
(RefSeq) interleukin-1 alpha isoform X1
  KO
K04383  interleukin 1 alpha
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04060  Cytokine-cytokine receptor interaction
oro04217  Necroptosis
oro04218  Cellular senescence
oro04380  Osteoclast differentiation
oro04640  Hematopoietic cell lineage
oro04932  Non-alcoholic fatty liver disease (NAFLD)
oro04933  AGE-RAGE signaling pathway in diabetic complications
oro04940  Type I diabetes mellitus
oro05020  Prion diseases
oro05133  Pertussis
oro05140  Leishmaniasis
oro05152  Tuberculosis
oro05162  Measles
oro05164  Influenza A
oro05321  Inflammatory bowel disease (IBD)
oro05323  Rheumatoid arthritis
oro05332  Graft-versus-host disease
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101382716 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101382716 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101382716 (IL1A)
   04218 Cellular senescence
    101382716 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101382716 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101382716 (IL1A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    101382716 (IL1A)
   05321 Inflammatory bowel disease (IBD)
    101382716 (IL1A)
   05332 Graft-versus-host disease
    101382716 (IL1A)
  09164 Neurodegenerative disease
   05020 Prion diseases
    101382716 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101382716 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101382716 (IL1A)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101382716 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101382716 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101382716 (IL1A)
   05152 Tuberculosis
    101382716 (IL1A)
  09172 Infectious disease: viral
   05162 Measles
    101382716 (IL1A)
   05164 Influenza A
    101382716 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101382716 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101382716 (IL1A)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101382716 (IL1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1 IL1_propep DNA_pol_alpha_N
Motif
Other DBs
NCBI-GeneID: 101382716
NCBI-ProteinID: XP_004399930
UniProt: A0A2U3VWR1
LinkDB All DBs
Position
Unknown
AA seq 265 aa AA seqDB search
MAKVPDLFEDLKNCYSENEEYSSEIDHLSLNQKSFYDVSYDPLYEDCMSLSTSKTSKTSQ
LTFKENVVVVAANGKVLKKRRLSLNQFITDDDLDGFTNDAEEEIMKPRSVAYNFHSNEKY
NYMRIIKSQFILNDNLNQSIIQQTGGNNLMAAALQNLEDAAKFDMGAYTSEDSKLPVTLR
ISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGTKNYFTSVAQPKLFIAT
QERKLVHMARGQPSITDFQILETQP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagttcctgacctttttgaagacctgaagaattgttacagtgaaaatgaagaa
tacagttctgaaattgaccatctttctctgaatcagaaatccttctatgatgtgagctat
gacccactttatgaggactgcatgtctctgagtacctccaaaacctcaaagacatctcag
cttaccttcaaggagaatgtggtggtggtggcagccaatgggaaggttctgaagaagaga
cggttgagtttaaatcaattcatcactgatgatgacctggatggctttaccaatgatgca
gaagaagaaatcatgaagcccagatcagtagcatacaacttccatagcaatgaaaaatac
aactatatgaggatcatcaaatcccaattcatcctgaatgacaacctcaatcaaagtata
attcaacaaacagggggaaataacctcatggctgctgcattgcagaatctggaagatgca
gcgaaatttgacatgggcgcttatacatcagaagattctaaacttcctgtgactctaaga
atctcaaaaactagactatttgtgagtgcccaaaatgaagatgaacctgtattgctaaag
gagatgcctgagacgcccaaaaccatcagagatgagaccaaccttctcttcttctgggaa
cgtcatggcactaagaactacttcacatcagttgcccagccaaagttgttcattgccaca
caggaacgaaaactggtgcacatggcaagagggcaaccctctatcactgactttcagata
ctggaaacccagccttga

DBGET integrated database retrieval system