KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382836Help
Entry
101382836         CDS       T05148                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro05034  Alcoholism
oro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    101382836 (HDAC10)
  09165 Substance dependence
   05034 Alcoholism
    101382836 (HDAC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oro03036]
    101382836 (HDAC10)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101382836 (HDAC10)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101382836 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101382836
NCBI-ProteinID: XP_004409722
UniProt: A0A2U3WLG2
LinkDB All DBs
Position
Unknown
AA seq 670 aa AA seqDB search
MRTALVYHEEMTAARLLWEDSECEIERPERLTAALERLQQGGLEQRCLQLAAREASEAEL
GLVHSPEYVSLLRGTQALGREELQALSGQYDAVYFHPSTFHCARLAAGAALQLVDAVLTG
AAHNGLALVRPPGHHSQRAAANGFCVFNNVAIAAKHAQQKHGLQRILIVDWDVHHGQGIQ
YIFEDDPSVLYFSWHRYEHGCFWPYLRESDADAVGLGQGRGFTVNLPWNQVGMGNADYMA
AFLHVLLPVAFEFDPELVLISAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV
LEGGYHLESLSQSVCMVVKALLGDPAPPLSGSMVPQHSALESIQSVRAAQAPHWTSLQQQ
GQWPAPLLNPRTCSPEGRRPPVSPGGPEFKAAEAQTSAVLRSLLDQLHLYPTPPVRTAAA
LTAQEAALVLPPDVLRQEASAPQEETQAWARLHKALAEDTAFIALGKVLHLLNGILDGQV
SGGIAAAPAAAATLEVAIRRGLSHRAQRVLCVAVGQLDRPPDLASDGRNLWLNIRGKEAA
ALSTFHVSLPLPATTGGFLSCILALVLPLAYGFQPDLVLVALGPAHGLQDPQAALLAALL
RGPAGGRILVLVEQESTPQLAGVLARVLHGEAPPSLGPFSVASPEDLQALTRLRGQLEVQ
WKMLQVAAPS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccgcactcgtgtaccatgaggaaatgacagccgcccggctgctctgggaagac
tctgagtgtgagatcgagcgtcccgagcgcctgaccgcagccctcgagcgcctgcagcag
gggggcctggagcagaggtgtctacagttggcagctcgagaggcttcagaggcagagctg
ggcctggtacacagcccagagtacgtgtccctgttgcgaggaacccaggccttgggtaga
gaggaactacaggctctgtctgggcagtacgatgctgtctactttcatccgagtaccttc
cactgtgcccggctggccgcgggggctgcgctgcagctggtggatgctgtgctcacagga
gccgcgcacaatgggcttgccctggtgagacctcctgggcaccacagccagagggctgct
gccaacgggttctgcgtgttcaacaacgtggccatagcagccaaacacgcccagcagaaa
catggtctgcaaaggatcctcattgtcgactgggatgtccaccatggtcagggcatccag
tatatctttgaggatgatcccagtgttctttacttctcctggcaccgctatgagcatggt
tgcttttggccttatcttcgagagtcagatgcagatgctgttgggctggggcagggccgt
ggcttcactgtcaacctgccctggaaccaggttgggatgggaaatgctgactatatggcc
gccttcctgcatgtgctgctccctgtggcctttgagtttgaccctgagctggtgctcatc
tcggcaggatttgactcagcgattggggatcctgaggggcagatgcaggccacacctgag
tgcttcgcccacctcacgcagctgctgcaggtgctggctggcggccgggtctgtgctgtg
ctggagggaggctaccatctggagtcgctgtcccagtcagtgtgcatggtggtgaaggcg
ctgctgggtgaccctgccccgcccctgtcggggtccatggtgcctcagcacagtgctctg
gagtccatccagagtgtccgggcagcgcaggcccctcactggactagccttcagcagcaa
ggtcagtggccggcccccttactgaaccccaggacctgctccccagaggggagacgccca
cctgtgtcgcctggggggcccgaattcaaggccgcagaggcccagacctcggctgtactg
aggtccctcctggaccagctgcacctctaccccacaccccccgtccgcacggctgccgcc
ctgacagcgcaggaggctgctctggtcctgccccctgacgtcctccgtcaagaggcgtca
gccccacaggaggagacacaggcctgggctaggctacacaaggccctggccgaggacacg
gctttcattgcacttggaaaggtcctgcatctattgaacgggatcctggacggacaggtg
agcggcggcatcgcagcagccccagcggcggcagccaccctggaggtggccattcggcgc
ggcctgtcccacagagcccagagggtgctctgtgtggctgtgggacagctggatcggccc
ccagaccttgccagtgatgggaggaatctgtggctgaacatcagaggcaaagaagcggct
gccctgtccacgttccatgtgtctctgccactgccagcgacaacaggtggattcttgagc
tgcatcctggcccttgtgctgcccctggcctatggcttccagcctgacctggtgctggtg
gcactgggaccagcccatggcctccaggacccccaagctgcactcctggctgcacttcta
cggggaccagcggggggccgaatcttggtcctagtggagcaggaatccacaccccagctt
gcgggggtcctggcccgggtgttgcatggagaggcaccccccagcctgggtcccttctcc
gtggcttcccccgaggacctgcaggccctgacacgcttgagagggcagctggaagtacag
tggaagatgctgcaggtggccgctccttcttga

DBGET integrated database retrieval system