KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383028
Entry
101383028         CDS       T05148                                 

Gene name
LCK
Definition
(RefSeq) tyrosine-protein kinase Lck
  KO
K05856  lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04064  NF-kappa B signaling pathway
oro04380  Osteoclast differentiation
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro05135  Yersinia infection
oro05166  Human T-cell leukemia virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101383028 (LCK)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101383028 (LCK)
   04660 T cell receptor signaling pathway
    101383028 (LCK)
   04658 Th1 and Th2 cell differentiation
    101383028 (LCK)
   04659 Th17 cell differentiation
    101383028 (LCK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101383028 (LCK)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101383028 (LCK)
  09163 Immune disease
   05340 Primary immunodeficiency
    101383028 (LCK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101383028 (LCK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101383028 (LCK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101383028 (LCK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oro03036]
    101383028 (LCK)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101383028 (LCK)
Protein kinases [BR:oro01001]
 Non-receptor tyrosine kinases
  SRC family
   101383028 (LCK)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101383028 (LCK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9 Kdo
Other DBs
NCBI-GeneID: 101383028
NCBI-ProteinID: XP_004406474
UniProt: A0A2U3WD75
LinkDB
Position
Unknown
AA seq 509 aa
MGCSCSSNPEDDWMENIDVCENCHYPIVPLDGKATLPIWNGSDVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQNGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDKGGFYISPRITFPGLHELVRHYANASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVQRLGAGQFGEVWMGYYNEHTKVAVKSLKQGSMSPDAFLAEANLMKKLQHRRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPPGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEERPTFDYLRSVLEDFFTATEGQYQPQP
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggctgtagctgcagctcaaaccctgaagatgactggatggaaaacatcgatgtatgt
gagaactgccattaccccatagtcccactggacggcaaggccacgctgcccatctggaat
ggctctgatgtgcgggatccactggttacctacgaaggctccaaccccccagcctcacca
ttgcaagataacctggttatcgctctgcacagctatgagccctctcacgatggagacttg
ggcttcgagaagggtgaacagctccggatcctggagcagaacggcgagtggtggaaggcg
cagtccctgaccacgggccaggaaggtttcatccccttcaacttcgtggccaaagcgaac
agcctggagccggaaccctggttcttcaagaacctgagccgcaaggacgctgagcggcag
ctcctggcgcccgggaacacgcacggctccttcctgatccgggagagcgagagcacggcc
ggatcgttctcactgtcggtgcgggacttcgaccagaaccagggagaggtggtgaaacat
tacaaaatccgtaacctggacaaaggcggcttctacatctccccccgcatcacttttcct
ggcctgcacgagctggtccgccattacgccaatgcttcggacgggctgtgcacgcggttg
agtcgcccctgccagacccagaagccccagaagccttggtgggaggacgagtgggaggtt
cccagggagacgctgaagctggtgcagcggctgggggctggccagttcggggaggtgtgg
atggggtactacaacgagcacacaaaggtggcagtgaagagcctgaagcagggcagcatg
tcccccgacgccttcctggccgaggccaacctcatgaagaagctgcaacaccggagactg
gtccggctctacgcggtggtcacccaggagcccatctacatcatcacggaatacatggag
aacgggagcctggtggatttcctcaagacccccccaggcatcaagctgaccatcaacaaa
ctcttggacatggcagcccaaattgcagagggcatggcattcattgaagagcggaactat
atccatcgtgacctgagggctgccaacatcctggtatctgacaccctgagctgcaagatt
gcagactttggcctagcacgcctcatcgaggacaacgagtacacagccagggagggagcc
aagtttcccattaagtggacagcaccagaagccattaactacgggacattcaccatcaag
tcagacgtgtggtcttttgggatcctgctgacggagattgtcacccacggccgcatccct
tacccagggatgaccaatcctgaggtgattcagaacctggagcgaggctaccgcatggtg
cgacctgacaactgtcccgaggagctgtaccacctcatgatgctgtgctggaaggagcgc
ccagaggaacggcccacctttgactacctgcgcagtgtgctggaggacttcttcacggcc
acagagggccagtaccagccccagccctga

DBGET integrated database retrieval system