KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383299
Entry
101383299         CDS       T05148                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04068  FoxO signaling pathway
oro04110  Cell cycle
oro04114  Oocyte meiosis
oro04115  p53 signaling pathway
oro04151  PI3K-Akt signaling pathway
oro04218  Cellular senescence
oro04914  Progesterone-mediated oocyte maturation
oro04934  Cushing syndrome
oro05160  Hepatitis C
oro05161  Hepatitis B
oro05162  Measles
oro05165  Human papillomavirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05169  Epstein-Barr virus infection
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05215  Prostate cancer
oro05222  Small cell lung cancer
oro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101383299 (CDK2)
   04151 PI3K-Akt signaling pathway
    101383299 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101383299 (CDK2)
   04114 Oocyte meiosis
    101383299 (CDK2)
   04115 p53 signaling pathway
    101383299 (CDK2)
   04218 Cellular senescence
    101383299 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101383299 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101383299 (CDK2)
   05203 Viral carcinogenesis
    101383299 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    101383299 (CDK2)
   05215 Prostate cancer
    101383299 (CDK2)
   05222 Small cell lung cancer
    101383299 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101383299 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101383299 (CDK2)
   05161 Hepatitis B
    101383299 (CDK2)
   05160 Hepatitis C
    101383299 (CDK2)
   05162 Measles
    101383299 (CDK2)
   05169 Epstein-Barr virus infection
    101383299 (CDK2)
   05165 Human papillomavirus infection
    101383299 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101383299 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oro03032]
    101383299 (CDK2)
   03036 Chromosome and associated proteins [BR:oro03036]
    101383299 (CDK2)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101383299 (CDK2)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101383299 (CDK2)
DNA replication proteins [BR:oro03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101383299 (CDK2)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101383299 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 101383299
NCBI-ProteinID: XP_004401699
UniProt: A0A2U3W1B4
LinkDB
Position
Unknown
AA seq 298 aa
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaaggtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acggagggtgtacccagtactgctatacgagagatctctctgcttaaggagcttaaccac
cctaacattgtcaagctgctggatgtcatccacacagaaaacaaactctacctggttttt
gagtttctgcatcaggatctgaagaaatttatggatgcctctgctttgactggcattcct
cttcccctcatcaagagttatctgttccagctgcttcagggcctagccttctgccattct
catcgggttctgcaccgagacctcaaacctcagaatctgcttatcaacgcagagggggcc
atcaagctagcagactttggactagccagagcctttggagttcctgttcgtacttacacc
catgaggtggtgaccctgtggtaccgagcacctgaaatccttctgggctgcaagtactac
tccacagctgtagatatctggagcctgggctgcatctttgctgaaatggtgacccgccgg
gccctattccctggagattctgaaattgaccaacttttccggatctttcggactctgggg
accccagatgaagtggtttggccgggagttacttctatgcctgattataagccgagcttc
cccaagtgggcccggcaagattttagcaaagttgttcctcccttggatgaagatggacgg
agcttgctatcgcaaatgctgcactacgaccccaacaagcggatttcggcaaaggcagct
ctggctcaccctttcttccaggatgtgaccaagccagtaccacaccttcgactctga

DBGET integrated database retrieval system