KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383468
Entry
101383468         CDS       T05148                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA isoform X1
  KO
K04513  Ras homolog gene family, member A
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04071  Sphingolipid signaling pathway
oro04072  Phospholipase D signaling pathway
oro04144  Endocytosis
oro04150  mTOR signaling pathway
oro04270  Vascular smooth muscle contraction
oro04310  Wnt signaling pathway
oro04350  TGF-beta signaling pathway
oro04360  Axon guidance
oro04510  Focal adhesion
oro04520  Adherens junction
oro04530  Tight junction
oro04611  Platelet activation
oro04621  NOD-like receptor signaling pathway
oro04625  C-type lectin receptor signaling pathway
oro04660  T cell receptor signaling pathway
oro04670  Leukocyte transendothelial migration
oro04722  Neurotrophin signaling pathway
oro04810  Regulation of actin cytoskeleton
oro04921  Oxytocin signaling pathway
oro04928  Parathyroid hormone synthesis, secretion and action
oro04972  Pancreatic secretion
oro05100  Bacterial invasion of epithelial cells
oro05132  Salmonella infection
oro05133  Pertussis
oro05135  Yersinia infection
oro05152  Tuberculosis
oro05163  Human cytomegalovirus infection
oro05200  Pathways in cancer
oro05203  Viral carcinogenesis
oro05205  Proteoglycans in cancer
oro05206  MicroRNAs in cancer
oro05210  Colorectal cancer
oro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101383468 (RHOA)
   04015 Rap1 signaling pathway
    101383468 (RHOA)
   04310 Wnt signaling pathway
    101383468 (RHOA)
   04350 TGF-beta signaling pathway
    101383468 (RHOA)
   04072 Phospholipase D signaling pathway
    101383468 (RHOA)
   04071 Sphingolipid signaling pathway
    101383468 (RHOA)
   04024 cAMP signaling pathway
    101383468 (RHOA)
   04022 cGMP-PKG signaling pathway
    101383468 (RHOA)
   04150 mTOR signaling pathway
    101383468 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101383468 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101383468 (RHOA)
   04520 Adherens junction
    101383468 (RHOA)
   04530 Tight junction
    101383468 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101383468 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101383468 (RHOA)
   04621 NOD-like receptor signaling pathway
    101383468 (RHOA)
   04625 C-type lectin receptor signaling pathway
    101383468 (RHOA)
   04660 T cell receptor signaling pathway
    101383468 (RHOA)
   04670 Leukocyte transendothelial migration
    101383468 (RHOA)
   04062 Chemokine signaling pathway
    101383468 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101383468 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    101383468 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101383468 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    101383468 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101383468 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    101383468 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101383468 (RHOA)
   05206 MicroRNAs in cancer
    101383468 (RHOA)
   05205 Proteoglycans in cancer
    101383468 (RHOA)
   05203 Viral carcinogenesis
    101383468 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101383468 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101383468 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101383468 (RHOA)
   05135 Yersinia infection
    101383468 (RHOA)
   05133 Pertussis
    101383468 (RHOA)
   05152 Tuberculosis
    101383468 (RHOA)
   05100 Bacterial invasion of epithelial cells
    101383468 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101383468 (RHOA)
Membrane trafficking [BR:oro04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    101383468 (RHOA)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101383468 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   101383468 (RHOA)
  Exosomal proteins of colorectal cancer cells
   101383468 (RHOA)
  Exosomal proteins of bladder cancer cells
   101383468 (RHOA)
GTP-binding proteins [BR:oro04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    101383468 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 101383468
NCBI-ProteinID: XP_004399293
UniProt: A0A2U3VV45
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt
ttgctcatcgtctttagcaaggaccagttcccagaagtgtatgtacccacagtgtttgag
aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca
gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggacc
ccggaagtcaagcacttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa
ccggaagaaggcagagatatggcaaacaggattggcgctttcggttacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacaagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system