KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383652
Entry
101383652         CDS       T05148                                 

Gene name
LAT
Definition
(RefSeq) linker for activation of T-cells family member 1
  KO
K07362  linker for activation of T cells
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04014  Ras signaling pathway
oro04015  Rap1 signaling pathway
oro04064  NF-kappa B signaling pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro05135  Yersinia infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101383652 (LAT)
   04015 Rap1 signaling pathway
    101383652 (LAT)
   04064 NF-kappa B signaling pathway
    101383652 (LAT)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101383652 (LAT)
   04660 T cell receptor signaling pathway
    101383652 (LAT)
   04658 Th1 and Th2 cell differentiation
    101383652 (LAT)
   04659 Th17 cell differentiation
    101383652 (LAT)
   04664 Fc epsilon RI signaling pathway
    101383652 (LAT)
   04666 Fc gamma R-mediated phagocytosis
    101383652 (LAT)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101383652 (LAT)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101383652 (LAT)
SSDB
Motif
Pfam: LAT
Other DBs
NCBI-GeneID: 101383652
NCBI-ProteinID: XP_012416769
UniProt: A0A2U3ZCQ2
LinkDB
Position
Unknown
AA seq 227 aa
MEAVVLIPCVLGLLLLPLLAGALCVRCRELPGSYDTTASDSLTPSSIVLKRPPTVVPWPS
ATSYAPVTSYPSLSQPDLLPIPRSPQPHHVPSSRQDSEGANSVASYENEEPVCEDEEEED
EDYHNEGYLEVLPDSTPAPSSAVPPAPVLSNPGLRDSAFSMESGEDYVNVLESEESADVS
LDGSREYVNVSQELPPMAKTEPAILSSQKVEDEDDEEEEGAPDYENL
NT seq 684 nt   +upstreamnt  +downstreamnt
atggaggccgtcgtcctcatcccctgcgtgctgggcctcctgctgctgcctctgctggcc
ggagcgctgtgtgtccgctgccgggagctgcccggctcttatgacactacggcctctgat
agcctgaccccaagcagcatcgtgctcaaacggcctcccacagttgtaccctggccatca
gccacctcctacgctcctgtcacctcctacccatccctgagccagccggacctgctccct
atcccgaggtccccccagccccaccacgtgccgtcttcccggcaggactcagagggtgcc
aacagtgtggcaagctatgagaacgaggagcccgtctgtgaggacgaggaggaggaagac
gaggactatcacaacgagggctacctggaggtgcttcccgatagcacgccagcccccagc
agcgctgtcccaccggctcctgtgctcagcaaccccggcctccgagacagcgccttctcc
atggagtcgggggaggattatgtgaacgtcctagagagcgaggagagtgcagacgtgtct
ctggatgggagccgggagtatgtgaacgtgtcccaggagctgccgcccatggctaagact
gagcctgccatcctgagctcccagaaggtggaggatgaagatgacgaagaggaagaggga
gctccagattatgagaatctgtag

DBGET integrated database retrieval system