KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383696
Entry
101383696         CDS       T05148                                 

Gene name
IL5
Definition
(RefSeq) interleukin-5
  KO
K05428  interleukin 5
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro04657  IL-17 signaling pathway
oro04658  Th1 and Th2 cell differentiation
oro04660  T cell receptor signaling pathway
oro04664  Fc epsilon RI signaling pathway
oro04672  Intestinal immune network for IgA production
oro05200  Pathways in cancer
oro05310  Asthma
oro05320  Autoimmune thyroid disease
oro05321  Inflammatory bowel disease
oro05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101383696 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101383696 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101383696 (IL5)
   04660 T cell receptor signaling pathway
    101383696 (IL5)
   04658 Th1 and Th2 cell differentiation
    101383696 (IL5)
   04657 IL-17 signaling pathway
    101383696 (IL5)
   04664 Fc epsilon RI signaling pathway
    101383696 (IL5)
   04672 Intestinal immune network for IgA production
    101383696 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101383696 (IL5)
  09163 Immune disease
   05310 Asthma
    101383696 (IL5)
   05320 Autoimmune thyroid disease
    101383696 (IL5)
   05321 Inflammatory bowel disease
    101383696 (IL5)
   05330 Allograft rejection
    101383696 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oro04052]
    101383696 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:oro00536]
    101383696 (IL5)
Cytokines and growth factors [BR:oro04052]
 Cytokines
  Interleukins
   101383696 (IL5)
Glycosaminoglycan binding proteins [BR:oro00536]
 Heparan sulfate / Heparin
  Cytokines
   101383696 (IL5)
SSDB
Motif
Pfam: IL5 DUF4301
Other DBs
NCBI-GeneID: 101383696
NCBI-ProteinID: XP_004408310
UniProt: A0A2U3WHS6
LinkDB
Position
Unknown
AA seq 134 aa
MKMLLHLSLLALGAAYVSVTAVESTMNRLVAETLTLLSAHRTLLIGDGNLMIPTPEHKNH
QLCIEEVFQGIDILKNQTAQGEAVDKLFQNLSLIKEHIDLQKKKCGGERWRVKKFLDYLQ
VFLGVINTEWTTES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaaaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact
gctgtagaaagtaccatgaatagactggtcgcagagaccttgacactgctctccgctcat
cgaactctgctgataggcgatgggaacctgatgattcctactcctgaacataaaaatcac
caattgtgcattgaagaagtctttcagggtatagacatattgaagaaccaaactgcacaa
ggggaggctgtggataaattattccaaaacttgtctttgataaaagaacacatagacctc
caaaaaaaaaagtgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa
gtgtttcttggtgtcataaacactgagtggacaacagaaagttga

DBGET integrated database retrieval system