KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383697
Entry
101383697         CDS       T05148                                 

Gene name
CD247
Definition
(RefSeq) T-cell surface glycoprotein CD3 zeta chain
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04650  Natural killer cell mediated cytotoxicity
oro04658  Th1 and Th2 cell differentiation
oro04659  Th17 cell differentiation
oro04660  T cell receptor signaling pathway
oro05142  Chagas disease
oro05169  Epstein-Barr virus infection
oro05170  Human immunodeficiency virus 1 infection
oro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101383697 (CD247)
   04660 T cell receptor signaling pathway
    101383697 (CD247)
   04658 Th1 and Th2 cell differentiation
    101383697 (CD247)
   04659 Th17 cell differentiation
    101383697 (CD247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101383697 (CD247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101383697 (CD247)
   05169 Epstein-Barr virus infection
    101383697 (CD247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101383697 (CD247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oro04147]
    101383697 (CD247)
   04090 CD molecules [BR:oro04090]
    101383697 (CD247)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101383697 (CD247)
CD molecules [BR:oro04090]
 Proteins
  101383697 (CD247)
SSDB
Motif
Pfam: ITAM TCR_zetazeta P53_tetramer
Other DBs
NCBI-GeneID: 101383697
NCBI-ProteinID: XP_012420667
UniProt: A0A2U3ZNU9
LinkDB
Position
Unknown
AA seq 185 aa
MAATASASWHQPGGKDKMTWKVLVMVALLQAQLPVTGAQSFGLLDPKLCYLLDGILFIYG
VILTALFLRAKFQFRRSAAAPQDQQGPNQLYNELNLRGREEYEVLDKRRGLDPETGGKQQ
RKRNPPEVVYNALQKDKMAEAYSEIGIKGENQRRRGKGHDGLYQGLSTATKDTYDALHMQ
TLPPR
NT seq 558 nt   +upstreamnt  +downstreamnt
atggctgccacagcctcggcatcctggcaccagcctgggggaaaggacaagatgacgtgg
aaggtgctggttatggtggccttgctgcaggcacagctcccggttacaggggcacagagc
tttggcctgctggatcccaaactgtgctacctgctggatgggatcctcttcatctatggc
gtcattctcactgccctgttcctgagagcaaagttccagttccgcaggagtgcggccgcc
ccccaagaccagcagggccccaaccagctctacaacgagctcaatctaagaggaagagag
gagtatgaggttttggataagagacgaggcctggaccctgagacgggaggaaaacagcag
aggaagaggaatcctccggaagtcgtgtacaacgcgctgcagaaagacaagatggcggag
gcctacagtgagattgggataaaaggcgagaaccagcgtcggcgagggaaggggcacgat
ggcctttaccaggggctcagcactgccaccaaggacacctatgatgccctccacatgcag
accctgcctcctcgctaa

DBGET integrated database retrieval system