KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383761Help
Entry
101383761         CDS       T05148                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00350  Tyrosine metabolism
oro01100  Metabolic pathways
Module
oro_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101383761 (GSTZ1)
Enzymes [BR:oro01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     101383761 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 101383761
NCBI-ProteinID: XP_004399375
UniProt: A0A2U3VVD7
LinkDB All DBs
Position
Unknown
AA seq 217 aa AA seqDB search
MTESGKPILYSYFRSSCSWRVRIALALKSIDYETVPINLIKDGGQQFSEEFQALNPMQQV
PALKIDGITIGQSLAIIEYLEETRPTPRLLPQDPKRRAQVRVISDVIASGIQPLQNLSVL
KQVGQENQLTWAQKVIHSGFNALEQILRSTAGKYCVGDEVSMADLCLVPQVANAERFKVD
LTPYPTISRINKTLLALEAFQVSHPCRQPDTPPELRA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtctggcaagcccatcctctactcctatttccggagctcctgctcatggaga
gttcgaattgctctggccttgaaaagcatcgactacgagaccgtacctatcaacctcata
aaggatgggggacagcagttctctgaagaattccaggcactgaatccaatgcagcaggtg
ccggccctgaagatcgacggaatcaccattggccagtcactggccatcattgagtacctg
gaggaaactcggcccactccacgcctcctgccgcaggacccgaagaggagggcccaggtg
cgcgtgatttccgatgtcattgccagtggcatccagcctctgcagaacctgtctgtcctg
aagcaagtaggacaggagaaccagctgacctgggcccagaaggtcatccactctggcttc
aacgctctggagcagatcctgcggagcacagcagggaagtactgtgtgggagacgaggtg
tccatggctgatctctgcttagtgcctcaggtggcaaacgctgaaaggttcaaggtggat
ctcactccctatcctaccatcagccgcatcaacaagacgctgctggccttggaggctttc
caagtgtctcacccctgccggcagccagacacaccgcctgagctgcgggcctag

DBGET integrated database retrieval system