KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383763
Entry
101383763         CDS       T05148                                 

Gene name
IL3RA
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04060  Cytokine-cytokine receptor interaction
oro04151  PI3K-Akt signaling pathway
oro04210  Apoptosis
oro04630  JAK-STAT signaling pathway
oro04640  Hematopoietic cell lineage
oro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101383763 (IL3RA)
   04151 PI3K-Akt signaling pathway
    101383763 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101383763 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101383763 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101383763 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101383763 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oro04050]
    101383763 (IL3RA)
   04090 CD molecules [BR:oro04090]
    101383763 (IL3RA)
Cytokine receptors [BR:oro04050]
 Interleukin receptor families
  IL3 receptor family
   101383763 (IL3RA)
CD molecules [BR:oro04090]
 Proteins
  101383763 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 101383763
NCBI-ProteinID: XP_012417679
UniProt: A0A2U3ZFC2
LinkDB
Position
Unknown
AA seq 462 aa
MALVWLMVFLTSVSGLLQMEEDPNLLIKNLRMEPGERRLTWDLHGNASEIMCFINSKLIT
KAIDNNRYCQFQVVPLCEVKNFTISLTKGPPFLMGIQYPLQEGNPGAAAQRLDCWVHDVD
FLTCSWEVGREAPSDVQYRLYWQELRTHREQECPHYEMDDRGKHVRCRFNDVSRLPKQLQ
ILVRGTSHGARIPCLDRSVELSEIERLSPPNITAMCNKSYSMMEWKASSHVNLRFEYELQ
IQKGSDPAYTEKLQENFFQIHNPGNYMARLKVKGFFRNTWSEWSAPQYFACDLGEDAQWP
NWLLTTLVLLGTLLALGLAVVLCGRYSVLQKLFPPIPHMKDPITDNLEGSKLVRQGFCWG
GWVGLGRGSHSPSRGAGCLCVGPGGRQGEAAGXRSREMDARPEALLQAGKAWSPGDPSAQ
DLSGSCGVSGSGWYPRLQVAWEASRASREDCPVAEVQVLGET
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggccttggtgtggctcatggtgtttctgacatctgtctccggtctgctgcaaatggag
gaagatcccaatttactgattaagaacctaaggatggagccgggagaaaggagactgacc
tgggacctccatggaaatgcttctgaaattatgtgtttcataaattcaaaacttatcact
aaggccatcgacaacaaccgttactgccagttccaagtagttcccttatgtgaagtgaaa
aacttcaccatctccttgaccaaaggcccaccattcttgatggggattcagtatcctctg
caagaaggaaaccctggggcggccgcacaacgtctggactgctgggtgcacgatgtggac
ttcctgacgtgcagctgggaggtgggcagggaggcccccagtgatgtccagtatcgcctg
tactggcaggagctgaggacccacagggagcaggagtgtccacattacgaaatggatgat
cgggggaaacacgtccggtgtcgtttcaatgatgtgtccagattgccgaaacagctccag
atcctggtgagaggcacaagccacggcgccaggatcccctgcttggaccgttctgtcgaa
ttatcagaaattgagagattaagtccacccaatatcactgcaatgtgtaacaaatcatat
tcgatgatggaatggaaagcgtcaagccacgtcaatctcagatttgagtacgaacttcaa
atacaaaagggcagcgatcccgcctacacagagaagctccaggaaaacttcttccagatt
cacaatcccgggaactacatggcgagactaaaggtgaaaggtttcttccgcaacacgtgg
agcgagtggagtgccccccaatactttgcgtgcgacctcggggaggacgcgcagtggccc
aactggctgttgaccacgctggtcttgctgggaacactgctggccctgggactcgcggtc
gtgctgtgtggaaggtactcagtgttgcagaagctctttcctcctatccctcacatgaaa
gaccccatcaccgacaaccttgagggcagcaagttggtacgtcagggcttctgctggggg
gggtgggtgggtctgggacggggtagccacagcccctcccggggagcaggatgcttgtgt
gttggtcctggcgggaggcagggggaggccgccgggtgacggtcacgtgagatggacgct
cgccccgaggcgctcctgcaggcaggcaaggcctggagccctggtgacccaagtgcccag
gacctgtcaggctcctgcggtgtttccgggtcggggtggtaccctcgcttgcaagtggcc
tgggaggccagcagagcaagcagggaggactgcccggtggcggaggtgcaggttttgggg
gagacatga

DBGET integrated database retrieval system