KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383919Help
Entry
101383919         CDS       T05148                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00010  Glycolysis / Gluconeogenesis
oro00053  Ascorbate and aldarate metabolism
oro00071  Fatty acid degradation
oro00280  Valine, leucine and isoleucine degradation
oro00310  Lysine degradation
oro00330  Arginine and proline metabolism
oro00340  Histidine metabolism
oro00380  Tryptophan metabolism
oro00410  beta-Alanine metabolism
oro00561  Glycerolipid metabolism
oro00620  Pyruvate metabolism
oro01100  Metabolic pathways
Module
oro_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101383919 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    101383919 (ALDH2)
   00620 Pyruvate metabolism
    101383919 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101383919 (ALDH2)
   00561 Glycerolipid metabolism
    101383919 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101383919 (ALDH2)
   00310 Lysine degradation
    101383919 (ALDH2)
   00330 Arginine and proline metabolism
    101383919 (ALDH2)
   00340 Histidine metabolism
    101383919 (ALDH2)
   00380 Tryptophan metabolism
    101383919 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101383919 (ALDH2)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101383919 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 101383919
NCBI-ProteinID: XP_004395895
UniProt: A0A2U3VLZ7
LinkDB All DBs
Position
Unknown
AA seq 521 aa AA seqDB search
MLRAAALAAAGLGPRLGRRLLSAATTQAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPT
INPSTGEVICQVAEGDKEDVDRAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLKCFRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN
IIPGFGPTAGAAITSHEDVDKVAFTGSTEVGRLVQVAAGSSNLKRVTLELGGKSPNIIMS
DADMNWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVERSVARAKFRVVGNPFDSQT
EQGPQVDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDSMTIAREE
IFGPVMQILKFKTIEEVIGRANNSNYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVF
GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgccgctgcgcttgccgccgctggcctcgggccccgcctgggccgccgtctc
ctgtcggccgccaccacccaggcggtgccggcccccaaccagcagcctgaagtcttctac
aaccagatcttcataaacaatgagtggcatgatgctgtcagcaagaaaacattccccacc
atcaatccatccaccggagaagtcatctgtcaggtagccgaaggagataaggaagacgtg
gacagggcagtaaaggctgcccgggccgccttccagctgggctcaccctggcgccgcatg
gatgcgtctgacaggggccgcctgctgaaccgcctggctgatctgattgagcgggaccgg
acctacctagcagccttggagaccctggataacggcaagccctatgtcatctcctacctg
gtggatctggacatggttctcaaatgcttccgttattacgctggctgggctgataagtac
cacgggaaaactattcccatcgatggggacttcttcagctatacccgccatgaacccgtc
ggggtgtgcgggcagatcattccgtggaacttcccgctcctgatgcaagcctggaaactc
ggcccagccctggcgaccggaaatgtggttgtgatgaaggtagctgagcagactccactg
actgccctctatgtggccaacctgattaaggaggctggctttccccctggcgtggtcaat
attattcctggatttggccccacagctggggccgccatcacctcccatgaggatgtggac
aaagtggccttcacaggctccaccgaggttggccgcctagtccaggttgccgcagggagc
agtaacctcaagagagtgaccctggagctggggggaaagagccccaatatcatcatgtca
gatgcagatatgaactgggctgtggagcaggcccacttcgccctgttcttcaaccagggc
cagtgctgctgtgcgggctcccggacctttgtgcaagaagatgtgtacgccgagtttgtg
gagaggagcgttgcccgggccaagtttcgtgtggttggtaacccctttgacagccagact
gagcaggggccgcaggtggatgaaactcagtttaagaagatccttggttatatcaaatct
gggaaggaggagggggcgaagctgctgtgtggtggaggggcggctgctgaccgtggctat
ttcatccagcccaccgtgttcggagatgtgcaagacagcatgactatcgccagggaggag
atctttgggccagtgatgcagatcctgaagttcaagaccatagaggaagtcattgggaga
gccaacaattccaactatgggctggctgcagctgtcttcaccaaggacttggacaaggcc
aattatctgtcccaagccctccaggctggcactgtgtgggtcaactgctatgatgtgttt
ggggcccagtccccattcggcggctacaagatgtctgggagcggccgggagctaggagag
tatgggctgcaggcatacaccgaagtgaaaaccgtcacggtcaaagtgcctcagaagaac
tcctga

DBGET integrated database retrieval system