KEGG   Odobenus rosmarus divergens (Pacific walrus): 101384069Help
Entry
101384069         CDS       T05148                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1 isoform X1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04110  Cell cycle
oro04213  Longevity regulating pathway - multiple species
oro04330  Notch signaling pathway
oro04919  Thyroid hormone signaling pathway
oro05016  Huntington's disease
oro05034  Alcoholism
oro05165  Human papillomavirus infection
oro05169  Epstein-Barr virus infection
oro05200  Pathways in cancer
oro05202  Transcriptional misregulation in cancer
oro05203  Viral carcinogenesis
oro05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:oro00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101384069 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101384069 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101384069 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    101384069 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101384069 (HDAC1)
   05202 Transcriptional misregulation in cancers
    101384069 (HDAC1)
   05203 Viral carcinogenesis
    101384069 (HDAC1)
   05220 Chronic myeloid leukemia
    101384069 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    101384069 (HDAC1)
  Substance dependence
   05034 Alcoholism
    101384069 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    101384069 (HDAC1)
   05165 Human papillomavirus infection
    101384069 (HDAC1)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101384069 (HDAC1)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101384069 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     101384069 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101384069 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    101384069 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101384069
NCBI-ProteinID: XP_004406478
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MAQTLGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQVIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactctgggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctacttaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgacgactacattaaattcttgcgctccatccgc
ccagataacatgtccgagtacagcaagcagatgcagagattcaacgtcggtgaggactgt
ccagtatttgatggcctgtttgaattctgtcagttatctactggtggctctgtggcgagt
gctgtgaaactgaataagcagcagacggacatcgctgtgaattgggccgggggcctgcac
catgcaaagaagtctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gacggtgtggaagaggccttctataccacagaccgggtcatgactgtgtcgtttcataaa
tacggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaag
tattacgctgttaactacccgctccgagatgggatcgatgacgagtcctatgaggccatt
ttcaagccggtcatatctaaagtgatggagatgttccagcccagtgcagttgtcttacag
tgtggctctgactccctgtccggggatcggttaggctgcttcaatctgaccatcaaaggg
cacgccaagtgtgtggagtttgtgaagagcttcaacctgcccatgctgatgctgggaggg
ggtggctacaccatccgcaacgtggcccgctgctggacgtatgaaacagccgtggccctg
gacacagagatcccgaatgagcttccgtacaacgactactttgaatactttggaccagac
ttcaaacttcacatcagtccttccaatatgaccaaccagaataccaatgaatacctggag
aagatcaaacagcgactgtttgagaacctgagaatgctgccccacgcacctggggtccaa
atgcaggtgattcctgaagatgccattccagaggagagtggcgacgaggatgaagaagac
cctgacaagcgcatctcgatctgttcttctgacaaacgaattgcctgtgaggaagagttc
tcggactctgatgaggagggggaaggtgggcgcaagaattcttccaacttcaaaaaagcc
aagagagtcaaaactgaggatgaaaaagagaaagacccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcaagaagctaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system