KEGG   Odobenus rosmarus divergens (Pacific walrus): 101384620Help
Entry
101384620         CDS       T05148                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04068  FoxO signaling pathway
oro04146  Peroxisome
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101384620 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101384620 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    101384620 (SOD2)
   04213 Longevity regulating pathway - multiple species
    101384620 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    101384620 (SOD2)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101384620 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 101384620
NCBI-ProteinID: XP_004401183
UniProt: A0A2U3W014
LinkDB All DBs
Position
Unknown
AA seq 222 aa AA seqDB search
MLSRAARSTSRTVVPALGSLASRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVN
NLNAIEEKYLEALEKGDITTQVALQPGLKFNGGGHINHSIFWTNLSPKGGGEPKGELLEA
IKRDFGSFDKFKEKLTTVSVGIQGSGWGWLGFSKEQRRLQIAACFNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcccgggcagcgcgcagcacgagccggacggtggtgccggcgctggggtcgctg
gcttccagacagaagcacagcctccccgacttgccgtacgattatggcgccctggagcct
cacatcaacgcccagatcatgcagctgcaccacagcaagcaccacgcgacctacgtgaac
aacctgaatgccatcgaggagaagtatctagaggcgctggagaagggtgacattacaact
caggtagctcttcagcctgggctcaagttcaatggcggaggccatataaatcattccatc
ttctggacaaacctgagccctaagggtggtggagaacccaaaggggaattgctggaagcc
atcaaacgtgattttggttccttcgacaaatttaaggagaagttgactactgtatccgtt
ggcatccaaggctcaggttggggttggcttggtttcagtaaggaacagagacgcttgcag
attgctgcttgttttaaccaggatcccctgcaaggaacaacaggtcttattccactactg
gggatcgatgtgtgggagcatgcttattaccttcagtataaaaatgtcagaccggattac
ctaaaagctatttggaatgttatcaactgggagaatgtaacggagagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system